(data stored in ACNUC31108 zone)

EMBL: S93788

ID   S93788; SV 1; linear; mRNA; STD; HUM; 818 BP.
XX
AC   S93788;
XX
DT   26-NOV-1993 (Rel. 37, Created)
DT   01-SEP-2004 (Rel. 81, Last updated, Version 4)
XX
DE   ocular melanoma-associated antigen [human, uveal melanoma, mRNA, 818 nt].
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 93788] from the original journal article.
RP   1-818
RX   PUBMED; 1339263.
RA   Wang M.X., Earley J.J.Jr., Shields J.A., Donoso L.A.;
RT   "An ocular melanoma-associated antigen. Molecular characterization";
RL   Arch. Ophthalmol. 110(3):399-404(1992).
XX
DR   MD5; f5fae716374d2ff65e055bda6e302ca1.
DR   Ensembl-Gn; ENSG00000135404; homo_sapiens.
DR   Ensembl-Tr; ENST00000257857; homo_sapiens.
DR   Ensembl-Tr; ENST00000420846; homo_sapiens.
DR   Ensembl-Tr; ENST00000546939; homo_sapiens.
DR   Ensembl-Tr; ENST00000549117; homo_sapiens.
DR   Ensembl-Tr; ENST00000550776; homo_sapiens.
DR   Ensembl-Tr; ENST00000552692; homo_sapiens.
DR   Ensembl-Tr; ENST00000552754; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..818
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..818
FT                   /gene="ocular melanoma-associated antigen, OMA81H"
FT   CDS_pept        25..741
FT                   /codon_start=1
FT                   /gene="ocular melanoma-associated antigen, OMA81H"
FT                   /product="ocular melanoma-associated antigen"
FT                   /note="OMA81H"
FT                   /db_xref="GOA:P08962"
FT                   /db_xref="H-InvDB:HIT000217255.12"
FT                   /db_xref="HGNC:HGNC:1692"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="InterPro:IPR042028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08962"
FT                   /protein_id="AAB21617.1"
FT                   /translation="MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQ
FT                   GATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAG
FT                   YVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKN
FT                   RVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIV
FT                   FACCLVKSIRSGYEVM"
XX
SQ   Sequence 818 BP; 167 A; 175 C; 249 G; 227 T; 0 other;
     ttgggaagcc caggcccggc agccatggcg gtggaaggag gaatgaaatg tgtgaagttc        60
     ttgctctacg tcctcctgct ggccttttgc gcctgtgcag tgggactgat tgccgtgggt       120
     gtcggggcac agcttgtcct gagtcagacc ataatccagg gggctacccc tggctctctg       180
     ttgccagtgg tcatcatcgc agtgggtgtc ttcctcttcc tggtggcttt tgtgggctgc       240
     tgcggggcct gcaaggagaa ctattgtctt atgatcacgt ttgccatctt tctgtctctt       300
     atcatgttgg tggaggtggc cgcagccatt gctggctatg tgtttagaga taaggtgatg       360
     tcagagttta ataacaactt ccggcagcag atggagaatt acccgaaaaa caaccacact       420
     gcttcgatcc tggacaggat gcaggcagat tttaagtgct gtggggctgc taactacaca       480
     gattgggaga aaatcccttc catgtcgaag aaccgagtcc ccgactcctg ctgcattaat       540
     gttactgtgg gctgtgggat taatttcaac gagaaggcga tccataagga gggctgtgtg       600
     gagaagattg ggggctggct gaggaaaaat gtgctggtgg tagctgcagc agcccttgga       660
     attgcttttg tcgaggtttt gggaattgtc tttgcctgct gcctcgtgaa gagtatcaga       720
     agtggctacg aggtgatgta ggggtctggt ctcctcagcc tcctcatctg ggggagtgga       780
     atagtatcct ccaggttttt caattaaacg gattattt                               818
//

If you have problems or comments...

PBIL Back to PBIL home page