(data stored in ACNUC30567 zone)

EMBL: U06146

ID   U06146; SV 1; linear; mRNA; STD; MUS; 140 BP.
XX
AC   U06146;
XX
DT   29-MAY-1994 (Rel. 39, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Mus musculus Balb/c clone 16#3 cellular disintegrin-related protein mRNA,
DE   partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-140
RX   DOI; 10.1073/pnas.91.7.2748.
RX   PUBMED; 8146185.
RA   Weskamp G., Blobel C.P.;
RT   "A family of cellular proteins related to snake venom disintegrins";
RL   Proc. Natl. Acad. Sci. U.S.A. 91(7):2748-2751(1994).
XX
RN   [2]
RP   1-140
RA   Blobel C.P.;
RT   ;
RL   Submitted (04-FEB-1994) to the INSDC.
RL   Carl P. Blobel, Cell. Biochem. and Biophys. Program, Memorial
RL   Sloan-Kettering Cancer Center, 1275 York Ave., New York, NY 10021, USA
XX
DR   MD5; 5c9a9b03df64771ef2af1c3aef71c9a8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..140
FT                   /organism="Mus musculus"
FT                   /strain="Balb/c"
FT                   /mol_type="mRNA"
FT                   /clone="16#3"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..>140
FT                   /codon_start=1
FT                   /product="cellular disintegrin-related protein"
FT                   /db_xref="GOA:Q60619"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="MGI:MGI:105988"
FT                   /db_xref="UniProtKB/TrEMBL:Q60619"
FT                   /protein_id="AAA18425.1"
FT                   /translation="TPKECTNKCCDARTCKIKAGFQCALGECCEKCQLKKPGVVCRAAK
FT                   D"
XX
SQ   Sequence 140 BP; 47 A; 25 C; 39 G; 29 T; 0 other;
     acacccaagg agtgtactaa caaatgctgt gatgcaagga cctgtaaaat taaagcaggt        60
     ttccagtgtg ccctggggga atgctgtgag aaatgccaac ttaaaaaacc tggggttgtg       120
     tgcagagcag caaaagatga                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page