(data stored in ACNUC23390 zone)

EMBL: AH005373

ID   AH005373; SV 3; linear; genomic DNA; STD; HUM; 7489 BP.
XX
AC   AH005373; U07663-U07664;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens HB9 homeobox protein gene, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-7489
RX   PUBMED; 7914194.
RA   Harrison K.A., Druey K.M., Deguchi Y., Tuscano J.M., Kehrl J.H.;
RT   "A novel human homeobox gene distantly related to proboscipedia is
RT   expressed in lymphoid and pancreatic tissues";
RL   J Biol Chem 269(31):19968-19975(1994).
XX
RN   [2]
RP   1-7489
RA   Kehrl J.H.;
RT   ;
RL   Submitted (12-MAR-1994) to the INSDC.
RL   John H. Kehrl, NIAID, National Institutes of Health, 9000 Rockville Pike,
RL   Bethesda, MD 20892, USA
XX
DR   MD5; f4ae3be27604d7fd0a428af39805532f.
XX
CC   On or before Jun 10, 2016 this sequence version replaced gi:507422,
CC   gi:558746, gi:22450748.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7489
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="placenta"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(2467..3341,5211..5371,5971..6986)
FT                   /product="HB9 homeobox protein"
FT   exon            2467..3341
FT                   /product="HB9 homeobox protein"
FT                   /number=1
FT   5'UTR           2467..2647
FT   CDS_pept        join(2648..3341,5211..5371,5971..6321)
FT                   /codon_start=1
FT                   /product="HB9 homeobox protein"
FT                   /protein_id="AAB60647.1"
FT                   /translation="MEKSKNFRIEPCWRWTPHEPPLAERALAKVTSPPVPASGTGGGGG
FT                   GGGASGGTSGSCSPASSEPPAAPADRLRAESPSPPRLLAAHCALLPKPGFLGAGGGGGG
FT                   TGGGHGGPHHHAHPGAAAAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGHP
FT                   VYGYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQLDQWLRASTAGM
FT                   ILPKMPDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKFNKYLSRPKRFEVATSLML
FT                   TETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGAGKGGAEEPGAEELLGPPAP
FT                   RDKGSGPPADLRDSDPEEDEDEDDEDHFPYSNGASVHAASSDCSSEDDSPPPRPSHQPA
FT                   PQ"
FT   intron          3342..>3905
FT                   /number=1
FT   gap             3906..4005
FT                   /estimated_length=unknown
FT   intron          <4006..5210
FT                   /number=1
FT   exon            5211..5371
FT                   /number=2
FT   intron          5372..5970
FT                   /number=2
FT   exon            5971..6986
FT                   /number=3
FT   3'UTR           6322..6986
XX
SQ   Sequence 7489 BP; 1430 A; 2304 C; 2254 G; 1401 T; 100 other;
     ggatcccaaa ctctctgaac ttgtactcta gaaaatggag agtgatagcc cgggcacgtc        60
     gctcatgcct gtaatccagc actttgggag gctgaagtgg gtggatcacc tgaggtcggg       120
     agttcgagac cagcctgacc aacatggtga aaccccatct ctactaaaaa cacaaaaatt       180
     aggcctggcc tggtggcaca tgcctgtaat ctcagctatt ggggaggctg aggcagaaga       240
     atcgcttgaa cctgggagat ggaggttgca gtgagccatg atcatggcat tgcactccag       300
     cccgggcaac aagaacaaaa ctccatctca aaaaaaaaaa aaaaaagtgg ggggcgcctg       360
     gcgcggtggc tgactcctgt aatcccagca ctttgggagg ccgaggcgcg cggatcagga       420
     ggtcaggcga tcaagaccat cctcgctaac acggtgaaac cccgtctcta ccaaaaatac       480
     aaaaaaaaaa aaagaaagaa aagaaaatgg agatacggag atgataaaaa tcttccttct       540
     agtgtcatag tgaagattac ggatgagaat tgcagaaagc tcatagcaca tagtaggtgt       600
     tcaagaaatg cgcgtgtttc cctctctcca gtgagaggta gaactgcatt tgtgtcacca       660
     caaagacatc taaaggcacg acaaactcca tgtgaatgcc tgggatttct ttttaccagt       720
     ggtcggctct gcaaagccag atcacattta ctccaagttg cagttactca tccattgcca       780
     tcctcctaac cttccaacca gtcctgtgca tctgggaact accctgtgtt ataatgaaaa       840
     cgataccact catggcaaca gagtcactgt catcaactct cgcctaggtc aaaagccttt       900
     tgaggagaag tggcaaggtc tctatatttg cctttttaaa aatccctctt gtagcaacct       960
     ggcgtgctaa ttttgaagtt tacctggcac tgagtttctc tttggctctc tcccctctcc      1020
     acagcccctt ccggtccttt attcacctct cacctgcata gcaagccctg gaacctggaa      1080
     ctccctccca gttctcacgc tggctgggga agataactgg gtctaatggc gctattgaca      1140
     aagcctggtg ttgatgccgc ttgacttccc gacccctgtg tggattcttt cagcttcaaa      1200
     aacgcccttg gaagtggttt tactgtaaat atttgaagtg tgcgtgtggg ggaggggtga      1260
     gacctggatg ctcactccgt gcctcgctca ctcacgggaa gccctttcct ctccacttcc      1320
     caggaggccc cggcagcacg agagacatag cctttccccg ctcctgcccg gggactggcc      1380
     gggggtcgca gcggcagggc ttccgaagga tgccgggccc cacgggtttt tcagggccga      1440
     ggtgtgtggg ccttgactcc cgcaagccca tgggcatccc tcggcagcga ggaagagcct      1500
     tgtcaccgag gacccgctcc actgagcagg cacgtgggcg acgtctgcaa gccgacttgg      1560
     gttctgcagg ccagagcgcc cagatctacc gtctccgcct tgactggggc aggggctccc      1620
     agagaggatt cgtggaggcc aaactcacac tcacatgcgc gtttacaccc ccacaccccc      1680
     gcacacacac ctgaaaatgc ggggccttcc catagcagat aaggttcgac ctgcagagct      1740
     ttggccacgg ggacaaaacc ctcccctgct gcgccctgga ggcccgagag cagggagggc      1800
     ttgggaaaca ccacggtctt cagtgcgctg ccgtcgcctc gcagagcggc caggtctgcg      1860
     cagcgtgggc gctcaggagc gtggaaccac cgcgctccgc aaggcagacg tggacccact      1920
     ccagcgccga caaggaggcc ggagaggacg cgcgcagctg gctccaggga ccaaccaagt      1980
     ccggaggggc ccacgtgtct cgggagcggg tcttgggccg ccgcggggct ctccaggggc      2040
     ccgggggttg ccagtgcccg ccgtccggct ccgcacccag gggagggcgg gcagaggccc      2100
     caggttgagc ctcggagtat ccactccccg ttggtgtccc cgcccgccag cgccgcgcaa      2160
     cagcccgggc tgcttaggac ctcgcggcgc gggggcgggg cggcgggcgg ccgggacggt      2220
     gacaggtgcg cccctcggcc aatggcggag cccgcggccc tccccgggcc cccgctgcgc      2280
     gcgccaatcg gaagccgcgc tgagcttcaa gtgcgcggag gggcgcgggt ccccaccacg      2340
     gcggcagcgg cctcggcgcg gtcgcctgag ggctgcagcg caaagaaccg ggctcccggg      2400
     cccggacgcg gggaagcact cgcgtgggag tttgtgcgag cgcggcccgg ggcggggccc      2460
     gcacggagga ggcgccggga ccatggtcac cctcggctga gtttccggcg gcgactttga      2520
     ttattggcaa ataaccacca taacaatacc gagcccccgg gcttgcaccg cacgcactga      2580
     ctccgcgagc ccgcacacgg ccgcgtcgcc cgccaccggg ccctgagcgc cagccccaaa      2640
     cgagccgatg gaaaaatcca aaaatttccg catcgagccc tgctggcggt ggacccccca      2700
     cgagccgcct ctcgcagagc gcgcgctggc caaggtcacg tcgccgcccg tgcccgcatc      2760
     tggcaccgga ggtggcggcg gcggcggcgg ggcgagcggc gggactagcg gcagctgcag      2820
     ccccgcgtcc tcggagccgc cggctgcgcc cgccgaccgc ctgcgcgccg agagcccgtc      2880
     gccgccgcgc ctgctggccg cgcactgcgc gctgctgccc aagccgggct tcctgggcgc      2940
     gggcggcggc ggcggcggca cgggcggcgg gcacgggggg ccccaccacc acgcgcatcc      3000
     gggcgcagcg gccgctgccg ccgccgccgc cgccgccgcc gccgccgccg ctgggggcct      3060
     ggcgctgggg ctgcaccctg ggggcgcgca gggcggcgcg ggcctcccgg cgcaggcggc      3120
     gctctacggc cacccggtct acggctactc cgcggcggcg gcggcggctg cgctggcggg      3180
     ccagcacccg gcgctctcct actcgtaccc gcaggtgcaa ggcgcgcacc ccgcgcaccc      3240
     cgccgacccc atcaagctgg gcgccggcac cttccagctg gaccagtggc tgcgcgcgtc      3300
     caccgcgggc atgatcctgc ctaagatgcc cgacttcaac tgtgagtacc ctgcggcccc      3360
     cgtggatgcg cgtggcggga gggcctcgcg catcctccac cggcaccgcc tgcccctctc      3420
     tgcgcttggc tcccagcgag cgggggaaga gctgcgaagc cgcctcggct ctgcccgggg      3480
     cctgcgagga ctcgcccgga cccccaggca tgagacgggc agcgaattat taaaatggcc      3540
     atgcgcaggc cttgccttct cttcctctct taacgggaag gggcagttgg aggtgtgaga      3600
     ctgagatcta atgattaacc cgaaggctgc aggagaagga agtcgccggg ggaaggcgag      3660
     ccgagagcgc cctgaattag gcaggcccgg gaatgggggt cagggcttat caccggggaa      3720
     aggaacttgg gccaggtccc ccactggggc gttagagaga cccgcggccc ctccagggag      3780
     agggagtgct tcaggagcag caaacaagag aaatgggctt cggaggcccg gggaggcaag      3840
     gccaaggccc agggaacccc cggctcttac cagggcgctg ccctcctctg gaagggcgtt      3900
     ggatcnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggggc cttgtttgac      4020
     taaagcaggg ggcgtgggcc atcctctaaa gcaaactgcc catcccgggg acctgagctc      4080
     atccaggcct ggggctggcc tcctttcttt cctttgcttt ctttctttta ttgtccaaca      4140
     cttgtcaggc tcctgggaaa tcaagggaag tctcgttttg aggtcataaa attctctgtg      4200
     atgtaaccgt gcgaaattat gtaaataaag ccgggcaggc ctccttgaac acacagagaa      4260
     ccggatcctg cctgcgcctc tgcctgtaat ttgcgtaatg agaattgtcc tgaaaaggct      4320
     tctagtctcc tcaggccttg cccctgccgc ccgcaccctg aggagggggc atgccaagga      4380
     aaacatttgg aaggtgggag ggtccctggt gaatacacag acttggaccc tgggtttggt      4440
     cctgttccac ctgtcctctc tcccttccct tcctcccttc cttccttcct tccttccttc      4500
     tttccttctt tccttcctcc ctccctcttt ccctctctcc cttccttcct tcctcttttt      4560
     ctcctcctcc tcctcctttt ctgtcttaag gaggcagtgc agggagacct ggaacagcag      4620
     gaccagctct tcccagacct gtttggatct gagcctgaat ctctaggaag gcgcagtagg      4680
     agagggggag agatttggtt ctcatcactc actgctcctt tattttatta ttttattatt      4740
     ttttatttat tgagagatgg ggtcttgctg tgtcacccag ggtacagtgc aggggtgcag      4800
     tctcgctcac tgcagccttc aactcctggg cttcccggaa cctcccttcc tggcccccga      4860
     ctggcctcag ttctcctctt gcctctgggt caatccactg ctaccaaagc cggctcctgt      4920
     ggagaggaag ctcctgcgat gggccctgtt taacagggac actcagacgt ctcctagaca      4980
     aaaaaaaaaa aaaaaattgg tctcattaac tccaaactat ccatttccac ttggtggtcc      5040
     tgagtccgca ttccttgggg agtgggcact gatagtgagg gaacagcccc gccctctgca      5100
     gggccaggcc ttggcgctgg ggccttgagt gtagtggtac aagcagcaac gggaggggct      5160
     ggggcgagga ccggagccgg ctgtgggcct cactgccctt tggtccccag cccaggcgca      5220
     gtcgaacctc ctggggaagt gccgccggcc gcgcaccgcc ttcaccagcc agcagctgct      5280
     ggagctggag caccagttca agttcaacaa gtacctgtcg cggcccaagc gcttcgaggt      5340
     ggccacctcg ctcatgctca ccgagaccca ggtgcgcgcc ctccccgccc ccgacgcatc      5400
     ccggcctccc aggggacact gttacctttg cacttgtgac ccacgggcgg tctgaggcat      5460
     ctagcgctgc gcctcgacgg ttcagacggc gggcgcacgg gttcatctaa ggtgcccaga      5520
     gcgccgattc agtagcttcg ggtggggccc aagaatcagc acttaaccac ccctcctttc      5580
     attctgaaga aggtgatccc caggccgcat tcgagaaatt ttgttccaga aagagaggag      5640
     ggaacatcct gagatttacc gcgacgtagc cagctgccct gacccttcct ccgcagacgg      5700
     agggcgcggg tagaaaagtc cccggcctgg gtcgttgggg acatagtcct agctcccacg      5760
     gagctccagc ccagctctgg ggtttgctgc tgagtggggg gttgcgggga ggaggaagct      5820
     acgagccccc tccccattcc gcttctaagt ctcaccctga ggccattcca gggccgaccc      5880
     aatggggccc aggcgcacgc ggggggactc cggggacagg aagccctggg gtggcggtgg      5940
     ccggtttctc acgcccgctt gtgcccgcag gtgaagattt ggttccagaa ccggcggatg      6000
     aaatggaaac gcagcaaaaa ggccaaagag caggcggcgc aggaagcgga gaaacagaag      6060
     ggcggcggcg ggggcgcggg gaagggcggc gcggaggagc cgggagccga ggagctgctg      6120
     gggccgccag cgccgcgaga caagggcagc ggaccgcctg cggacttgag ggacagtgac      6180
     cccgaggagg acgaggacga ggacgacgag gaccatttcc cctacagcaa cggcgccagc      6240
     gtccacgccg cctcctccga ctgctcctcg gaggacgact cgccgccccc gcggcccagc      6300
     caccagcccg cgccccagta ggagccccgc gcccagcagg tgcggcgcgc acggagccgc      6360
     cggccggcgg cttctcccgg aggccccggc gcccgcaccc acccggcccg gccccgagag      6420
     caggctcgac cgccgcccca tggacccctc gcccaggccg gggctggagg gattcggccg      6480
     cggctccggt cctgggcgct tcccttttaa gcaagggcgc ctcacctgct cttcaagaaa      6540
     cagcgagagg gagacccagg gggctgaaac ttgaactctg gttcttttaa aattaatttt      6600
     ggttggtgtt gggggaggcg cgagtgcgtg tgagaagaac cgacccaccc cgcgcaaggg      6660
     gaagcctcct gtctcccctt tccccgcgtc cgagaaggcg gaaacccaca gtgttacctg      6720
     acttatgaaa cttgaaaccg cctctggagc cgccattctg cagagtattt ggaaaaagaa      6780
     aaaagggttt atgcttacgt ctctggggtc ggggggatta tgtcacgagc gttcaaactg      6840
     ctggaaatct caaaactgta ctgtctttat ttttgtatat tgtatttata tataaaaaga      6900
     aacgtctacg tatgcatgct aaattattat ttagcttctc ccatcgccca cgatggaatg      6960
     taaaataaat tggttttgta ctggatcagc gtgcacgagt tttgggggat tatgcccgcg      7020
     gcattacaat ttgcttgtag aaatgatggg gagggtgtct actcggcggt tggcagctga      7080
     gggtgaaaat cggagtctca agtgggtgtc aggaccacct ccgcgcctgc tactggggag      7140
     tcgcaatgtg aagtgttggc aaaaatacct gtggccaggt gtcagcgcat gcccggctgc      7200
     ctggtgcaca cctgtcccgg gacacgtgtc cctcggaagc ggagctgtgg actctattta      7260
     ttttcctatt tccttgctag ctgttgcttc gttggcactc cagaagtgga aatacgctat      7320
     ttggacgttt cagaaaataa gcttaaaacg actaggcgtt agtagcatgt ggggtccctg      7380
     tgacctccag gcgctactga ggcacatttc ccggaacgca ccgaattgcg cggtgcttct      7440
     ctctctcctc gaccccggtc tctgttagca gaaccttcct tggctggcc                  7489
//

If you have problems or comments...

PBIL Back to PBIL home page