(data stored in ACNUC7421 zone)

EMBL: U09529

ID   U09529; SV 1; linear; genomic DNA; STD; PRO; 1030 BP.
XX
AC   U09529;
XX
DT   26-MAY-1994 (Rel. 39, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Salmonella typhimurium LT2 ApbA protein (apbA) gene, complete cds.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Typhimurium
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-1030
RX   PUBMED; 7519593.
RA   Downs D.M., Petersen L.;
RT   "apbA, a new genetic locus involved in thiamine biosynthesis in Salmonella
RT   typhimurium";
RL   J. Bacteriol. 176(16):4858-4864(1994).
XX
RN   [2]
RP   1-1030
RA   Downs D.D.M.;
RT   ;
RL   Submitted (10-MAY-1994) to the INSDC.
RL   Diana D. M. Downs, Bacteriology, University of Wisconsin-Madison, 1550
RL   Linden Dr., Madison, WI 53706, USA
XX
DR   MD5; 30994562debe42e218c6bce44004d009.
DR   EuropePMC; PMC107496; 9721324.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1030
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhimurium"
FT                   /map="10 minutes"
FT                   /strain="LT2"
FT                   /mol_type="genomic DNA"
FT                   /clone="pAPB3"
FT                   /db_xref="taxon:90371"
FT   regulatory      30..35
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      54..59
FT                   /regulatory_class="minus_10_signal"
FT   CDS_pept        102..947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbA"
FT                   /product="ApbA protein"
FT                   /db_xref="GOA:P37402"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37402"
FT                   /protein_id="AAA56681.1"
FT                   /translation="MKITVLGCGALGQLWLSALCKHGHDVQGWLRVPQPYCSVNLIDTD
FT                   GSFFNESLTANDPDFLAKSELLLVTLKAGFRRSTNPGVNLPVTSPILLIHNGMGTIEEL
FT                   QNIQQPMLMGTITHAARDGNIIIHVANGTTHIGPAREQDGDYSYLADILQGVLPDVAWH
FT                   NNIRAEMWRKLAVNCVINPLTALWNCPNGELRHHTDEINAICEEVAAVIEREGYHTSAD
FT                   DLRYYVEQVIDSTAENISSMFEDVRAMRHTEIDYITGYLLKRARVHGLAFRKIAACLKW
FT                   "
XX
SQ   Sequence 1030 BP; 259 A; 268 C; 275 G; 228 T; 0 other;
     agcgcggttt ttggctcccg cccctgctcg cggcaaagct tagctgatga cgctataatt        60
     agcgccataa cacctggcgc tgttgcaggt gaggaggaac aatgaaaatt actgtactgg       120
     gatgcggagc cttaggacaa ctttggcttt cggcactgtg caaacacgga catgacgtac       180
     agggctggct acgggtgcca caaccttatt gcagcgtaaa tctgatcgat accgatggtt       240
     cctttttcaa cgaatcactg acggcaaacg atccggattt tttggcgaag agcgaactgt       300
     tattagtcac gctgaaagca ggtttccgac gcagtacgaa ccctggcgtc aacctaccgg       360
     tgacgtcgcc tatcctgctc attcataatg gaatgggaac catagaagaa ctgcaaaata       420
     tccaacagcc gatgttgatg gggactatca cccatgctgc gcgcgacggt aatatcatta       480
     ttcatgtcgc taacggtact acgcatattg gcccggcgcg cgagcaagac ggcgattaca       540
     gttatctcgc cgatatcctg cagggggtac tgcccgatgt cgcctggcat aacaatatcc       600
     gcgcagagat gtggcgcaaa ctggcggtca actgtgttat caacccgctc accgcgcttt       660
     ggaactgccc gaacggcgag ctgcgccatc atactgatga aatcaacgcg atttgcgaag       720
     aggtcgccgc cgtgattgaa cgtgaaggct accacacatc ggcagacgat ttacgctatt       780
     atgttgagca agtgattgac agtacggcag aaaacatctc atccatgttc gaggacgtgc       840
     gtgccatgcg ccataccgaa attgactaca tcaccggtta tttactcaag cgcgcccgcg       900
     tgcacggtct cgcgttccgg aaaatagccg cctgtttgaa atggtaaagc gaaaggagag       960
     tgagtatgag cgctacggca ctggtatgcc tcgcccctgg tagtgaagag accgaagcgg      1020
     tcaccactat                                                             1030
//

If you have problems or comments...

PBIL Back to PBIL home page