(data stored in ACNUC9552 zone)

EMBL: U10579

ID   U10579; SV 1; linear; unassigned DNA; STD; ROD; 764 BP.
XX
AC   U10579;
XX
DT   28-JUN-1995 (Rel. 44, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Rattus norvegicus Bcl-x (bcl-x) gene, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-764
RA   Wesselingh S.L., David G.L., Choi S., Veliuona M., Hardwick J.M.;
RT   "Cloning and expression of rat bcl-x in cultured neurons";
RL   Unpublished.
XX
RN   [2]
RP   1-764
RA   Hardwick J.M.;
RT   ;
RL   Submitted (13-JUN-1994) to the INSDC.
RL   J. Marie Hardwick, Neurology, Johns Hopkins School of Medicine, 600 North
RL   Wolfe St., Baltimore, MD 21287-7681, USA
XX
DR   MD5; 2603273dad0b46c55b913e9df0d95757.
DR   Ensembl-Gn; ENSRNOG00000007946; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000010762; rattus_norvegicus.
DR   EuropePMC; PMC18458; 9435230.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..764
FT                   /organism="Rattus norvegicus"
FT                   /mol_type="unassigned DNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        39..740
FT                   /codon_start=1
FT                   /gene="bcl-x"
FT                   /product="Bcl-x"
FT                   /db_xref="GOA:P53563"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="PDB:1AF3"
FT                   /db_xref="PDB:4QNQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53563"
FT                   /protein_id="AAA19257.1"
FT                   /translation="MSQSNRELVVDSLSYKLSQKGYSWSQFSDVEENRTEAPEETEPER
FT                   ETPSAINGNPSWHLADSPEVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRA
FT                   FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLV
FT                   SRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAG
FT                   VVLLGSLFSRK"
XX
SQ   Sequence 764 BP; 192 A; 187 C; 229 G; 156 T; 0 other;
     tggacaatgg actggttgag cccatctcta ttataaaaat gtctcagagc aaccgggagc        60
     tggtggttga ctccctctcc tacaagctct cccagaaagg atacagctgg agtcagttta       120
     gcgatgtcga agagaacagg actgaagccc cagaagaaac tgaaccagaa agggagaccc       180
     ccagtgccat caatggcaac ccatcctggc acctggcgga tagccccgag gtgaatggag       240
     ccactggcca cagcagcagt ttggatgcgc gggaggtaat ccccatggca gcagtgaagc       300
     aagcgctgag agaggctggc gatgagtttg aactgcggta ccggagagca ttcagtgatc       360
     taacatccca gcttcatata accccaggga cagcatatca gagctttgaa caggtagtga       420
     atgaactctt tcgggatggg gtaaactggg gtcgcattgt ggccttcttc tcctttggcg       480
     gggcactgtg cgtggaaagc gtagacaagg agatgcaggt attggtgagt cggattgcaa       540
     gttggatggc cacctacctg aatgaccacc tagagccttg gatccaggag aacggcggct       600
     gggacacttt tgtggatctc tacgggaaca atgcagcagc cgagagccgg aaaggccagg       660
     agcgtttcaa ccgctggttc ctgacgggca tgactgtggc tggtgtagtt ctgctgggct       720
     cactcttcag tcggaagtga ccagacactg accatccact ctac                        764
//

If you have problems or comments...

PBIL Back to PBIL home page