(data stored in ACNUC27125 zone)

EMBL: U13919

ID   U13919; SV 1; linear; genomic DNA; STD; FUN; 2125 BP.
XX
AC   U13919;
XX
DT   30-DEC-1994 (Rel. 42, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Emericella nidulans calmodulin-dependent protein phosphatase catalytic
DE   subunit (cnaA+) gene, complete cds.
XX
KW   .
XX
OS   Aspergillus nidulans
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-2125
RX   PUBMED; 8013455.
RA   Rasmussen C., Garen C., Brining S., Kincaid R.L., Means R.L., Means A.R.;
RT   "The calmodulin-dependent protein phosphatase catalytic subunit
RT   (calcineurin A) is an essential gene in Aspergillus nidulans";
RL   EMBO J. 13(11):2545-2552(1994).
XX
RN   [2]
RP   1-2125
RA   Rasmussen C.D.;
RT   ;
RL   Submitted (23-AUG-1994) to the INSDC.
RL   Colin D. Rasmussen, Anatomy & Cell Biology, University of Alberta, MSB
RL   5-61, Edmonton, Alberta T6G 2H7, Canada
XX
DR   MD5; 4eded5a4432cad2562d2a29ec07fec79.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2125
FT                   /organism="Aspergillus nidulans"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="lambda gt11 library of G.S. May"
FT                   /note="anamorph = Aspergillus nidulans"
FT                   /db_xref="taxon:162425"
FT   5'UTR           1..150
FT   exon            <151..196
FT                   /gene="cnaA+"
FT                   /number=1
FT   CDS_pept        join(151..196,256..587,633..890,942..1856,1904..1945)
FT                   /codon_start=1
FT                   /gene="cnaA+"
FT                   /product="calmodulin-dependent protein phosphatase
FT                   catalytic subunit"
FT                   /note="calcineurin A"
FT                   /db_xref="GOA:P48457"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48457"
FT                   /protein_id="AAA57873.1"
FT                   /translation="MEDGTQVSTLERVVKEVQAPALNKPSDDQFWDPEEPTKPNLQFLK
FT                   QHFYREGRLTEDQALWIIQAGTQILKSEPNLLEMDAPITVCGDVHGQYYDLMKLFEVGG
FT                   DPAETRYLFLGDYVDRGYFSIECVLYLWALKIWYPNTLWLLRGNHECRHLTDYFTFKLE
FT                   CKHKYSERIYEACIESFCALPLAAVMNKQFLCIHGGLSPELHTLEDIKSIDRFREPPTH
FT                   GLMCDILWADPLEDFGQEKTGDYFIHNSVRGCSYFFSYPAACAFLEKNNLLSVIRAHEA
FT                   QDAGYRMYRKTRTTGFPSVMTIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCTPHPYW
FT                   LPNFMDVFTWSLPFVGEKITDIVIAILNTCSKEELEDETPSTISPAEPSPPMPMDTVDT
FT                   ESTEFKRRAIKNKILAIGRLSRVFQVLREESERVTELKTAAGGRLPAGTLMLGAEGIKQ
FT                   AITNFEDARKVDLQNERLPPSHDEVVRRSEEERRIALDRAQHEADNDTGLATVARRISM
FT                   VRRIRKIPSTTRR"
FT   intron          197..255
FT   exon            256..587
FT                   /gene="cnaA+"
FT                   /number=2
FT   intron          588..632
FT   exon            633..890
FT                   /gene="cnaA+"
FT                   /number=3
FT   intron          891..941
FT   exon            942..1856
FT                   /gene="cnaA+"
FT                   /number=4
FT   intron          1857..1903
FT   exon            1904..>1945
FT                   /gene="cnaA+"
FT                   /number=5
FT   3'UTR           1946..2125
XX
SQ   Sequence 2125 BP; 519 A; 547 C; 524 G; 535 T; 0 other;
     tgttctgtct tggtgtgttc acgagcagct aggttcttgc gatttgtctt gccagataat        60
     tctcgccatt gccccaagat ggatcggaat ctagcgcgcg ctgtggccga taagcagccg       120
     gttccggaaa ttgatttcac cctgcatgtc atggaagatg gcacccaggt gtccacccta       180
     gaacgtgttg tcaaaggtgt gtgctattga ttcaactttt ggtgataccg cagctgaaca       240
     ttgatgtttc ctcagaggtg caagcacccg ccttgaacaa accatcagac gatcagtttt       300
     gggaccccga agaaccaacg aaacctaatc tccagtttct caagcaacac ttctatcggg       360
     agggtcgcct taccgaggac caggcgctat ggattataca ggcgggtact caaatcctga       420
     agtcggagcc caacctgctg gaaatggacg cgcccataac tgtgtgcggt gatgttcacg       480
     ggcagtacta cgatctgatg aagctgtttg aggtgggagg agaccctgct gagacgcgtt       540
     atcttttcct gggcgactat gtcgatcgag gctacttcag tattgaggtg agttccctgc       600
     ctctaatcac tcggcctgtc tgaccttttc agtgtgtcct gtacctatgg gcactgaaga       660
     tctggtatcc gaatacactc tggttgcttc gcggcaacca cgaatgtcga cacttgacag       720
     attattttac tttcaagttg gaatgtaagc ataaatatag cgagcgcatc tatgaagcct       780
     gcattgagtc gttttgcgcg ctgccgctgg cggcggttat gaataagcag ttcctctgta       840
     ttcacggtgg tttgagccct gaactgcaca ctttagaaga catcaaatcg gtatgttacg       900
     cgatgctgaa tacttcaaca gggtcaggct aacctgccta gatcgatcga ttcagagaac       960
     ccccaactca cgggctcatg tgcgatatcc tctgggccga tcctttggag gacttcggtc      1020
     aagagaagac tggcgactac tttattcata atagcgttcg agggtgctcc tactttttct      1080
     cataccctgc cgcgtgtgct ttcctcgaga agaacaactt gctctcagtc attcgagctc      1140
     acgaggctca ggacgcggga taccgcatgt accgcaagac gcggactaca ggatttccca      1200
     gtgtcatgac cattttcagc gcaccgaact acttggatgt atacaacaac aaagccgccg      1260
     tcctgaaata cgagaacaat gtcatgaaca tccgacaatt caactgcacc cctcaccctt      1320
     actggcttcc caacttcatg gatgtgttca cctggtctct gccgtttgtc ggtgagaaga      1380
     ttaccgacat cgttattgcc attctcaaca cttgctccaa ggaagagctt gaagacgaga      1440
     caccctctac catctcccct gccgagccgt ctccaccgat gccgatggac acagtggata      1500
     cagagagtac cgagttcaaa cgacgtgcta tcaagaacaa gattctcgcc attggccggt      1560
     tgtctcgagt cttccaagtg ctgcgtgagg agtctgaacg tgttacggaa cttaagaccg      1620
     cggctggagg tcgacttcct gccggtactt taatgcttgg tgcggaagga attaagcaag      1680
     ccatcacgaa ctttgaagat gcccgcaaag ttgatttaca gaacgaacgt ctcccgcctt      1740
     ctcacgatga ggtcgtcaga cgaagcgaag aggaaagacg catcgccctt gaccgcgccc      1800
     aacacgaagc tgataacgat actggccttg ccacagttgc aaggcgcatt agcatgtgag      1860
     ttttattgtc ctcgtgcggc tatcaactgc taataaacca taggtccgtc ggatcaggaa      1920
     aatcccgtcg acaacgagac ggtagtcggg gactagaaca tatgacgaaa attggatatt      1980
     aaccccgact tggtctattc cccttataga caccatctaa cacgaattac tccctcaatt      2040
     gttgtagtct gctcgttttg gacctgtatg gaatccccat ctcataggac ggggttaatg      2100
     tcaggaagaa gggcgtttgt ctagg                                            2125
//

If you have problems or comments...

PBIL Back to PBIL home page