(data stored in ACNUC1829 zone)

EMBL: U14650

ID   U14650; SV 1; linear; mRNA; STD; HUM; 1458 BP.
XX
AC   U14650;
XX
DT   26-SEP-1994 (Rel. 41, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Human platelet-endothelial tetraspan antigen 3 mRNA, complete cds.
XX
KW   PETA-3; platelet-endothelial tetraspan antigen; TM4SF protein;
KW   transmembrane glycoprotein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1458
RX   PUBMED; 7632941.
RA   Fitter S., Tetaz T.J., Berndt M.C., Ashman L.K.;
RT   "Molecular cloning of cDNA encoding a novel platelet-endothelial cell
RT   tetra-span antigen, PETA-3";
RL   Blood 86(4):1348-1355(1995).
XX
RN   [2]
RP   1-1458
RA   Fitter S.;
RT   ;
RL   Submitted (14-SEP-1994) to the INSDC.
RL   Steve Fitter, Institute of Medical and Veterinary Science, Hanson Centre
RL   For Cancer Research, Rundle Mall, Adelaide, South Australia 5000, Australia
XX
DR   MD5; 787ae035a9654557e23dd27e8d2bdd19.
DR   Ensembl-Gn; ENSG00000177697; homo_sapiens.
DR   Ensembl-Tr; ENST00000322008; homo_sapiens.
DR   Ensembl-Tr; ENST00000397420; homo_sapiens.
DR   Ensembl-Tr; ENST00000397421; homo_sapiens.
DR   Ensembl-Tr; ENST00000530726; homo_sapiens.
DR   EuropePMC; PMC24397; 9826724.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1458
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="M07e cDNA library in Bluescript KS (+)"
FT                   /clone="pGP27.1 and pGP27.2"
FT                   /cell_line="megakaryoblastic cell line M07e"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        60..821
FT                   /codon_start=1
FT                   /standard_name="PETA-3"
FT                   /product="platelet-endothelial tetraspan antigen 3"
FT                   /note="cell surface glycoprotein; PETA-3 is similar to
FT                   members of the newly defined Transmembrane 4 superfamily
FT                   (TM4SF) which are characterized by the presence of 4
FT                   putative transmembrane domains"
FT                   /db_xref="GOA:P48509"
FT                   /db_xref="H-InvDB:HIT000218272.12"
FT                   /db_xref="HGNC:HGNC:1630"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48509"
FT                   /protein_id="AAA87064.1"
FT                   /translation="MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQD
FT                   WRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRV
FT                   IGAVGIGIACVQVFGMIFTCCLYRSLKLEHY"
FT   regulatory      1440..1445
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1458
FT                   /note="8 A residues"
XX
SQ   Sequence 1458 BP; 269 A; 459 C; 433 G; 297 T; 0 other;
     tcgcccccgc agctgccgcc gccgccaggg cccggactcg gacgcgtggt agccccagga        60
     tgggtgagtt caacgagaag aagacaacat gtggcaccgt ttgcctcaag tacctgctgt       120
     ttacctacaa ttgctgcttc tggctggctg gcctggctgt catggcagtg ggcatctgga       180
     cgctggccct caagagtgac tacatcagcc tgctggcctc aggcacctac ctggccacag       240
     cctacatcct ggtggtggcg ggcactgtcg tcatggtgac tggggtcttg ggctgctgcg       300
     ccaccttcaa ggagcgtcgg aacctgctgc gcctgtactt catcctgctc ctcatcatct       360
     ttctgctgga gatcatcgct ggtatcctcg cctacgccta ctaccagcag ctgaacacgg       420
     agctcaagga gaacctgaag gacaccatga ccaagcgcta ccaccagccg ggccatgagg       480
     ctgtgaccag cgctgtggac cagctgcagc aggagttcca ctgctgtggc agcaacaact       540
     cacaggactg gcgagacagt gagtggatcc gctcacagga ggccggtggc cgtgtggtcc       600
     cagacagctg ctgcaagacg gtggtggctc tttgtggaca gcgagaccat gcctccaaca       660
     tctacaaggt ggagggcggc tgcatcacca agttggagac cttcatccag gagcacctga       720
     gggtcattgg ggctgtgggg atcggcattg cctgtgtgca ggtctttggc atgatcttca       780
     cgtgctgcct gtacaggagt ctcaagctgg agcactactg accctgcctt gggccttgct       840
     gctgctgcac ccaactactg agctgagacc actgagtacc aggggctggg ctccctgatg       900
     acacccaccc tgtgccatca ccataacctc tggggacccc aacctcagag gcagcttcaa       960
     gtgccttttg ctgcgcacca atgcccagca ggggaggtga ggggggctgg cggggcgaag      1020
     tttggggggt gttttgtggg gctccccgga catactctct gcctggtggt cagatgcagg      1080
     ttggaagggg ccttgctgag tggcgcaagg ccgagcgttc ccagcagggg gagaaaccct      1140
     tcacacccca ggcccttcag gaactggggc tttgccttgc agccacatgg ccccatccca      1200
     gttggggaag ccaggtgagc tctgaccctt gggcctgggc ctctgcccct cccaacccag      1260
     ccgtcgtctc cctcgacagc gcccctgctg tcttccccac cgcagtcacc accacccgaa      1320
     atgccacgtg gtcactgtgc actgccctgt tcatgtgcct ctgcggggca gggccttcct      1380
     ggttttgtac actgctgtac ccagatgcct acaaccatcc ctgccacata caggtgctca      1440
     ataaacactt gtagagca                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page