(data stored in SCRATCH zone)

EMBL: U15147

ID   U15147; SV 1; linear; genomic DNA; STD; PRO; 2095 BP.
XX
AC   U15147;
XX
DT   25-OCT-1994 (Rel. 41, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Bacillus subtilis proton/glutamate symport protein (GltP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-2095
RX   PUBMED; 7751298.
RA   Tolner B., Ubbink-Kok T., Poolman B., Konings W.N.;
RT   "Characterization of the proton/glutamate symport protein of Bacillus
RT   subtilis and its functional expression in Escherichia coli";
RL   J. Bacteriol. 177(10):2863-2869(1995).
XX
RN   [2]
RP   1-2095
RA   Tolner B.;
RT   ;
RL   Submitted (27-SEP-1994) to the INSDC.
RL   Berend Tolner, Microbiology, University of Groningen, Kerklaan 30, Haren,
RL   Groningen, Nl-9751-Nn, The Netherlands
XX
DR   MD5; f71190f0eb9e5b6f766a28f8d84001a6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2095
FT                   /organism="Bacillus subtilis"
FT                   /strain="6GM"
FT                   /mol_type="genomic DNA"
FT                   /clone="pGTU100"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /note="similar to several PTS IIA proteins or domains,
FT                   including proteins encoded by Bacillus stearothermophilus
FT                   PTS glucose-specific permease, GenBank Accession Number
FT                   U12340, and Bacillus subtilis
FT                   protein-N(pi)-phosphohistidine-sugar phosphotransferase,
FT                   GenBank Accession Number X12832.; TTG is used as an
FT                   alternate start codon"
FT                   /db_xref="GOA:P39816"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011299"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39816"
FT                   /protein_id="AAA82877.1"
FT                   /translation="DQVFSEKMMGEGFAIIPSEGKVVAPADGEIVSIFPTKHAIGFMSA
FT                   GGTEILIHVGIDTVKLNGEGFEAHVTSGQAVKQGELLLTFDLNYIKQHAASAITPVIFT
FT                   NTSEEDLKHIQMK"
FT   regulatory      355..384
FT                   /regulatory_class="terminator"
FT   regulatory      436..441
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      457..463
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      485..492
FT                   /gene="GltP"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        499..1743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GltP"
FT                   /product="proton/glutamate symport protein"
FT                   /function="glutamate uptake"
FT                   /db_xref="GOA:P39817"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39817"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAA82878.1"
FT                   /translation="MKKLIAFQILIALAVGAVIGHFFPDFGMALRPVGDGFIRLIKMIV
FT                   VPIVFSTIVIGAAGSGSMKKMGSLGIKTIIWFEVITTLVLGLGLLLANVLKPGVGLDLS
FT                   HLAKKDIHELSGYTDKVVDFKQMILDIIPTNIIDVMARNDLLAVIFFAILFGVAAAGIG
FT                   KASEPVMKFFESTAQIMFKLTQIVMVTAPIGVLALMAASVGQYGIELLLPMFKLVGTVF
FT                   LGLFLILFVLFPLVGLIFQIKYFEVLKMIWDLFLIAFSTTSTETILPQLMDRMEKYGCP
FT                   KRVVSFVVPSGLSLNCDGSSLYLSVSCIFLAQAFQVDMTLSQQLLMMLVLVMTSKGIAA
FT                   VPSGSLVVLLATANAVGLPAEGVAIIAGVDRVMDMARTGVNVPGHAIACIVVSKWEKAF
FT                   RQKEWVSANSQTESI"
FT   regulatory      1744..1780
FT                   /gene="GltP"
FT                   /regulatory_class="terminator"
XX
SQ   Sequence 2095 BP; 529 A; 475 C; 469 G; 622 T; 0 other;
     gatcaggtct tttcagaaaa aatgatgggc gagggatttg cgattatacc atcagaagga        60
     aaagtcgttg cacctgcgga cggcgagatc gtctcgattt ttccgacaaa acacgccatc       120
     ggctttatga gcgccggcgg cactgaaatc ctgattcatg tcggcatcga taccgtcaaa       180
     ctgaatgggg aaggctttga agcacatgtc acaagcggac aagccgtcaa acaaggcgaa       240
     ctgcttctca cctttgatct caattacatc aagcagcatg ccgcttcagc cataacaccg       300
     gttattttca caaatacctc tgaagaagat ctaaagcaca ttcaaatgaa gtaaaaaagt       360
     cccccctgct gcgggggact ttttcgccaa cataatgaaa gcgctgtcaa aataaaataa       420
     cttgaaaaaa ggtgtttgca tttgaatcac gaatgatatg aatatgccta cattctatcg       480
     ttctaaaggg ggattcattt gaaaaaatta atcgcgtttc aaattttaat cgctttggct       540
     gtcggcgcgg tgatcggcca cttttttcct gatttcggga tggcactgag gcctgtcgga       600
     gatggattta tccgcctgat taaaatgatt gttgtgccga ttgtattttc taccattgtc       660
     attggagccg caggaagcgg aagcatgaaa aaaatgggca gtctcggcat caagacgatc       720
     atttggttcg aagtgattac aacgttggta ttagggcttg gacttttatt agcgaatgtc       780
     ttaaaaccag gtgtcgggct tgacctctcc catttggcaa aaaaagatat tcatgaactt       840
     tccggctaca cagacaaagt tgttgatttc aagcaaatga tcctggatat tatccctaca       900
     aacattattg atgtcatggc cagaaatgat ttgcttgccg ttattttctt cgccatttta       960
     tttggtgtcg ccgcagctgg tatcggcaaa gcttctgaac cagtaatgaa gttttttgaa      1020
     tctacagctc agattatgtt caagctcacg caaatcgtca tggtcactgc tcctatcggc      1080
     gtgttagccc tgatggctgc ttctgtaggc caatatggca ttgaactcct cctccctatg      1140
     tttaagctgg ttggcaccgt attccttggc ctgttcctga tcctctttgt cctctttccg      1200
     cttgtcggtc tcatctttca gattaagtat ttcgaagtat tgaaaatgat atgggatctg      1260
     tttttaattg cattttccac cacaagcact gaaaccattc tccctcagct gatggataga      1320
     atggagaaat acggctgtcc caaacgagtg gtatcatttg tcgttccctc cggcttgtca      1380
     ttgaactgtg acggctccag cttatattta tcggtttctt gtatctttct cgcacaggcc      1440
     tttcaagtag acatgacatt gtcccagcag ctgctcatga tgcttgtgct tgtgatgacc      1500
     agtaaaggca ttgcagctgt accctcagga tcgcttgtag ttcttctggc gactgccaat      1560
     gctgtaggac tgccggctga aggcgttgcc attatcgcgg gtgttgaccg cgtcatggac      1620
     atggcgagaa caggcgtgaa cgtaccggga catgcgatcg cctgtatcgt ggtatcaaaa      1680
     tgggaaaagg ccttccgcca aaaagaatgg gtttccgcaa acagccaaac tgaaagcata      1740
     tagaaaaaaa gaacacctca atacgaggtg ttcttttttt attcagcagc agcgtgatct      1800
     tctgtttcaa tcgctgccag tcttgcgttt acttcttctt ctgtcatatt atgctctttc      1860
     acatacgggt ttcttgggtt cgtgccggca ttcgtggctg cagctgcgca tatatttata      1920
     ctcattttcc ggtgtgcata tcattttttt attgcaagat ggatttggcg cagttcacat      1980
     aacgctcaca cggttctcct gtaaagtagt ccttgccaca atcacatgct cgacaacggt      2040
     tgacaggcac gctgattctt tcatcaaata cgtagcactg gccgtcccaa agctt           2095
//

If you have problems or comments...

PBIL Back to PBIL home page