(data stored in SCRATCH zone)

EMBL: U17292

ID   U17292; SV 1; linear; genomic DNA; STD; PRO; 3400 BP.
XX
AC   U17292;
XX
DT   16-SEP-1995 (Rel. 45, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Bacillus subtilis ATPase (opuAA), transmembrane protein (opuAB) and glycine
DE   betaine-binding protein precursor (opuAC) genes, complete cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-3400
RX   DOI; 10.1074/jbc.270.28.16701.
RX   PUBMED; 7622480.
RA   Kempf B., Bremer E.;
RT   "OpuA, an osmotically regulated binding protein-dependent transport system
RT   for the osmoprotectant glycine betaine in Bacillus subtilis";
RL   J Biol Chem 270(28):16701-16713(1995).
XX
RN   [2]
RP   1-3400
RA   Kempf B.;
RT   ;
RL   Submitted (18-NOV-1994) to the INSDC.
RL   Bettina Kempf, Biochemie, Max-Planck-Institut fuer Terrestrische
RL   Mikrobiologie, Karl-von-Frisch-Strasse, Marburg D-35043, Germany
XX
DR   MD5; 93e9f9f5f1d72da968f2a6be914a5fca.
DR   EuropePMC; PMC127567; 11976081.
DR   EuropePMC; PMC515146; 15342567.
DR   EuropePMC; PMC94542; 10850986.
DR   GOA; P54983.
DR   InterPro; IPR002933; Peptidase_M20.
DR   InterPro; IPR011650; Peptidase_M20_dimer.
DR   InterPro; IPR017439; Amidohydrolase.
DR   InterPro; IPR036264; Bact_exopeptidase_dim_dom.
DR   InterPro; IPR037484; AmhX-like.
DR   UniProtKB/Swiss-Prot; P54983; AMHX_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3400
FT                   /organism="Bacillus subtilis"
FT                   /map="upstream of amyE"
FT                   /strain="Marburg 168 (JH642)"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      215..220
FT                   /gene="opuAA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        226..1482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /product="ATPase"
FT                   /db_xref="GOA:P46920"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46920"
FT                   /protein_id="AAC43455.1"
FT                   /translation="MSVDEKPIKIKVEKVSKIFGKQTKKAVQMLANGKTKKEILKATGS
FT                   TVGVNQADFEVYDGEIFVIMGLSGSGKSTLVRMLNRLIEPTAGNIYIDGDMITNMSKDQ
FT                   LREVRRKKISMVFQKFALFPHRTILENTEYGLELQGVDKQERQQKALESLKLVGLEGFE
FT                   HQYPDQLSGGMQQRVGLARALTNDPDILLMDEAFSALDPLIRKDMQDELLDLHDNVGKT
FT                   IIFITHDLDEALRIGDRIVLMKDGNIVQIGTPEEILMNPSNEYVEKFVEDVDLSKVLTA
FT                   GHIMKRAETVRIDKGPRVALTLMKNLGISSIYAVDKQKKLLGVIYASDAKKAAESDLSL
FT                   QDILNTEFTTVPENTYLTEIFDVVSDANIPIAVVDEKQRMKGIVVRGALIGALAGNNEY
FT                   INAEGTNEQTQDPSAQEVK"
FT   regulatory      1469..1474
FT                   /gene="opuAB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1484..2332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAB"
FT                   /product="transmembrane protein"
FT                   /db_xref="GOA:P46921"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46921"
FT                   /protein_id="AAC43456.1"
FT                   /translation="MDRLPRIPLADIIDRFVDWITMTFGGFFDGIANGLAAFVNGIVTG
FT                   LGFIPSILLTIIFAALAWWISTRGIALFTLIGFLLIDYLGYWDPMLQTLALVLTSVIIS
FT                   IVVGVPIGIWASQKETVRRIVTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFA
FT                   MPPTIRMTVLGIKQVPADLIEATEAFGSTTAQRLFKVQLPLATKTILAGINQSIMLALS
FT                   MVVIAAMVGAPGLGSEVYSAVTQLKTGVGVEAGIAIVIVAITLDRITQNIKVKKKSRGN
FT                   A"
FT   regulatory      2318..2323
FT                   /gene="opuAB"
FT                   /regulatory_class="ribosome_binding_site"
FT   sig_peptide     2332..2391
FT                   /gene="opuAC"
FT   CDS_pept        2332..3213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAC"
FT                   /product="glycine betaine-binding protein precursor"
FT                   /db_xref="GOA:P46922"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="PDB:2B4L"
FT                   /db_xref="PDB:2B4M"
FT                   /db_xref="PDB:3CHG"
FT                   /db_xref="PDB:5NXX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46922"
FT                   /protein_id="AAC43457.1"
FT                   /translation="MLKKIIGIGVSAMLALSLAACGSENDENASAAEQVNKTIIGIDPG
FT                   SGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKL
FT                   KYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPA
FT                   KVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTL
FT                   TQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQY
FT                   MKNVNSIEDLKK"
FT   mat_peptide     2392..3213
FT                   /gene="opuAC"
FT                   /product="glycine betaine-binding protein"
FT   regulatory      3222..3240
FT                   /regulatory_class="terminator"
XX
SQ   Sequence 3400 BP; 1020 A; 666 C; 849 G; 865 T; 0 other;
     gaattcaatt ccaataaaag cgttttcaac taaaggtagg agaaaaatca cccgtaaaat        60
     acaatcatat aggaggatta cagagcattt agaagcataa ataagatcat gtggtcacat       120
     ggatgtttat aaagaaatgg tacagaataa aagagaatat gctgtttgtg tgggaagtta       180
     cataaatgtt acggtaataa agattgctta atatggaggg aaaatatgag tgtagatgag       240
     aaaccaatta agataaaagt cgagaaagtc tctaagattt ttgggaaaca aacaaagaag       300
     gcagttcaaa tgcttgccaa cggaaagaca aaaaaagaga tcctgaaagc aaccggatca       360
     accgttgggg ttaatcaggc agattttgaa gtatatgatg gtgagatatt tgtcatcatg       420
     ggtctatcag ggagcggtaa atcaacttta gtacggatgt taaaccggct tattgaaccg       480
     actgccggaa atatttacat tgatggtgac atgataacaa atatgtcaaa agaccagctc       540
     cgggaagtcc gccggaaaaa aatcagcatg gtcttccaaa agttcgctct gtttccgcac       600
     agaacgatac ttgaaaacac agaatacgga ctggagcttc aaggtgtaga caaacaagag       660
     cggcagcaaa aagcgcttga gtctcttaag ctcgttggac tggaaggatt tgaacaccaa       720
     tatcccgacc agctttccgg cgggatgcag cagcgtgtcg gccttgcccg cgcgttgacg       780
     aatgacccgg acatccttct gatggacgaa gcgttcagtg cgctcgatcc actgattcgt       840
     aaagatatgc aggatgagct tcttgatctt cacgataatg tcggaaaaac aattatcttt       900
     attacgcatg acttggacga agcgttgcgg atcggcgaca gaattgtcct aatgaaggac       960
     ggcaacatcg ttcaaatcgg cacgcctgaa gaaatcctga tgaatccatc taacgaatat      1020
     gttgagaaat tcgtcgaaga tgttgatttg tctaaagtcc tcacagcagg ccacattatg      1080
     aaacgcgctg aaacagtgcg gattgataaa gggcctcgcg tagcattgac actgatgaaa      1140
     aaccttggaa tttcttcaat ttatgcagtg gataaacaaa agaaattatt aggtgttatc      1200
     tatgcgtctg atgcgaaaaa agcggctgag tctgatttgt cacttcaaga catcttgaat      1260
     acagaattta cgactgtacc agagaatacg tatctgactg agatttttga cgttgtgtcc      1320
     gatgcgaata ttccaattgc ggttgtggat gagaagcaaa gaatgaaagg aattgtcgta      1380
     agaggcgcgc tgattggcgc acttgccggc aataacgagt atatcaatgc tgaaggcact      1440
     aacgaacaaa cacaagatcc ttctgcacag gaggtgaaat aagatggata gactgcctag      1500
     aataccttta gcagatatta ttgaccgttt tgttgactgg attacgatga cgtttggcgg      1560
     attcttcgac ggaatcgcta acggattggc cgcttttgta aatggaattg tcaccggtct      1620
     tggatttatt ccatctattt tgttaacgat tattttcgcc gcacttgcgt ggtggatcag      1680
     tacaagggga attgcgttat ttacgttgat tggattcctc ctgatcgatt atttaggata      1740
     ttgggaccca atgctgcaaa cattggcgct tgttttgaca tctgtgatta tttcgattgt      1800
     ggtcggggtt ccgatcggaa tttgggcgtc tcagaaagaa acggttcgcc gtattgtaac      1860
     gccaattctt gatttaatgc agacaatgcc tgctttcgta tatctattgc cggcgatttt      1920
     cttctttaac atcggtgttg tgccgggtgt tgttgcatct gttatcttcg cgatgccgcc      1980
     gacaatccgc atgactgttc tcggtattaa acaagtgccg gcggatttga ttgaagcgac      2040
     tgaggcattc ggttctacaa cagctcagcg tttgtttaaa gttcagctcc cgcttgcgac      2100
     aaaaacgatt ttggccggga tcaaccagag catcatgctt gcgttatcaa tggttgttat      2160
     cgccgcaatg gtcggtgcac cgggacttgg ttctgaagta tacagtgccg ttacacagct      2220
     gaaaaccggg gtcggagtag aggccggtat cgccatcgtt atcgttgcca ttaccctgga      2280
     ccgtattact caaaatatta aagtgaagaa gaaaagcagg gggaatgcct gatgcttaaa      2340
     aaaatcatag gcatcggcgt ttccgccatg ctggcgctct cacttgcggc ttgcggttca      2400
     gaaaacgatg aaaatgcatc cgcagcagaa caagtgaata agaccatcat cgggattgac      2460
     cccggttcag ggattatgtc cctgactgac aaagcgatga aggattatga cctgaatgac      2520
     tggacattga tttcagcgtc aagtgctgcg atgaccgcta cgcttaaaaa gtcatacgac      2580
     cgtaagaaac cgattatcat tacaggatgg acaccgcact ggatgttctc cagatataag      2640
     ctgaaatatc tcgatgatcc gaaacaatct tatggcagcg cagaggaaat ccatacgatc      2700
     acacgcaaag gcttcagcaa agagcagccg aatgccgcaa agcttctgag ccagtttaaa      2760
     tggacgcagg acgaaatggg cgaaatcatg atcaaggtgg aagaaggcga gaaacctgcc      2820
     aaagttgctg ctgagtacgt caataaacac aaggatcaga ttgccgaatg gacaaaaggc      2880
     gttcaaaagg tgaagggaga caaaatcaac cttgcctatg tggcgtggga cagtgagatt      2940
     gcaagtacaa acgtcatagg caaagtctta gaagacttgg gctatgaggt aacacttact      3000
     caggtagagg ctgggccgat gtggactgca attgcgacgg gaagtgcgga tgcatccctt      3060
     tccgcatggc tgccgaatac ccataaagca tacgccgcta aatataaagg caaatatgat      3120
     gatattggca ccagtatgac tggtgtgaag atggggcttg ttgttcctca atatatgaaa      3180
     aatgtcaact caattgaaga tttgaagaag taatcaaaaa agcagcctgt gtcaggctgc      3240
     tttttttgcg ttaagaagcg ttagcggcag caagtgattc cgccttctga aatgttttga      3300
     gcacggcgtt cgccaaaata tgaatgccgg taaacatcgc atttctgtca aaggtcatgt      3360
     gcggatgatg gagccccggc tggagcccgc agcctagtcc                            3400
//

If you have problems or comments...

PBIL Back to PBIL home page