(data stored in ACNUC13479 zone)

EMBL: U17343

ID   U17343; SV 1; linear; mRNA; STD; MUS; 850 BP.
XX
AC   U17343;
XX
DT   18-DEC-1994 (Rel. 42, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus signal recognition particle receptor beta subunit mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-850
RX   DOI; 10.1083/jcb.128.3.273.
RX   PUBMED; 7844142.
RA   Miller J.D., Tajima S., Lauffer L., Walter P.;
RT   "The beta subunit of the signal recognition particle receptor is a
RT   transmembrane GTPase that anchors the alpha subunit, a peripheral membrane
RT   GTPase, to the endoplasmic reticulum membrane";
RL   J. Cell Biol. 128(3):273-282(1995).
XX
RN   [2]
RP   1-850
RA   Miller J.D.;
RT   ;
RL   Submitted (20-NOV-1994) to the INSDC.
RL   Joshua D. Miller, Biochemistry and Biophysics, University of California,
RL   San Francisco, 3rd and Parnassuss, San Francisco, CA 94143-0448, USA
XX
DR   MD5; 8eba488df7afebb3326c1149179a244a.
DR   Ensembl-Gn; ENSMUSG00000032553; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035194; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035174; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035106; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035167; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034877; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034189; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034846; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035007; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034955; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035083; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034994; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035709; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033896; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034309; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000035157; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093925; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0094009; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093962; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093935; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093512; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094449; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094110; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093431; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093641; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093495; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093649; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093471; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094776; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093547; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092509; mus_musculus_wsbeij.
DR   EuropePMC; PMC1460730; 10471706.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..850
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        21..830
FT                   /codon_start=1
FT                   /product="signal recognition particle receptor beta
FT                   subunit"
FT                   /note="SRP receptor beta subunit"
FT                   /db_xref="GOA:P47758"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:102964"
FT                   /db_xref="PDB:2FH5"
FT                   /db_xref="PDB:2GO5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47758"
FT                   /protein_id="AAA69976.1"
FT                   /translation="MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAV
FT                   LLTLVFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVN
FT                   NNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLID
FT                   SMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQ
FT                   LGKKGKEFEFSQLPLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA"
XX
SQ   Sequence 850 BP; 195 A; 219 C; 244 G; 192 T; 0 other;
     gaagactaca cacctctttc atggcttcgg cgaacacccg gcgagttggc gatggcgccg        60
     gtggcgcctt ccagccttac ctcgactcct tacgacagga gctgcagcag agggatccga       120
     cgctgctctc cgtggcggtg gctctcctgg cggtgctgct gacgctggtg ttctggaagt       180
     tcatctggag ccgaaagagc agtcagagag ctgttctctt cgttggtctc tgtgactctg       240
     ggaaaacgtt gctgtttgtc aggttgctaa ctggccagta cagagacaca cagacttcca       300
     ttaccgatag ttctgccata tacaaagtca acaataacag gggtaacagc ctgactctga       360
     tcgacctccc cgggcatgag agcttgaggt ttcagctctt agatcgcttt aagtcttcag       420
     ctagggctgt ggtgtttgtg gtggacagtg cggcgttcca gcgggaggtg aaagatgtgg       480
     ccgaatttct gtaccaggtc ctcatcgaca gcatggctct gaagaactca ccgtccttat       540
     taatagcctg caataagcaa gatatcgcaa tggcaaaatc agcgaagttg atccagcagc       600
     agcttgagaa ggagctcaac accttacgag tcacccggtc cgcggctccc agcacactgg       660
     acagttccag caccgcacct gctcagttgg ggaagaaagg caaagaattt gaattttccc       720
     agttgccact caaagtggag ttcctggagt gtagtgccaa gggtggacga ggggacactg       780
     gctctgctga catccaggac ttggagaagt ggctggccaa gattgcctga ggagcatcgc       840
     tggccacaag                                                              850
//

If you have problems or comments...

PBIL Back to PBIL home page