(data stored in ACNUC8465 zone)

EMBL: U17743

ID   U17743; SV 1; linear; mRNA; STD; HUM; 1310 BP.
XX
AC   U17743;
XX
DT   05-MAY-1995 (Rel. 43, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Human JNK activating kinase (JNKK1) mRNA, complete cds.
XX
KW   JNK-activating kinase; JNKK.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1310
RX   DOI; 10.1126/science.7716521.
RX   PUBMED; 7716521.
RA   Lin A., Minden A., Martinetto H., Claret F.X., Lange-Carter C.,
RA   Mercurio F., Johnson G.L., Karin M.;
RT   "Identification of a dual specificity kinase that activates the Jun kinases
RT   and p38-Mpk2";
RL   Science, e1252229 268(5208):286-290(1995).
XX
RN   [2]
RP   1-1310
RA   Karin M.;
RT   ;
RL   Submitted (29-NOV-1994) to the INSDC.
RL   Michael Karin, Pharmacology, University of California at San Diego, 9500
RL   Gilman Dr., La Jolla, CA 92093, USA
XX
DR   MD5; fbac82e61daabfd1593eaa1a6c838721.
DR   Ensembl-Gn; ENSG00000065559; homo_sapiens.
DR   Ensembl-Tr; ENST00000353533; homo_sapiens.
DR   Ensembl-Tr; ENST00000415385; homo_sapiens.
DR   EuropePMC; PMC129784; 12368479.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1310
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="hJNKK1"
FT                   /db_xref="taxon:9606"
FT   gene            21..1220
FT                   /gene="JNKK1"
FT   CDS_pept        21..1220
FT                   /codon_start=1
FT                   /gene="JNKK1"
FT                   /standard_name="C-jun N-terminal kinase kinase 1"
FT                   /product="JNK activating kinase"
FT                   /db_xref="GOA:P45985"
FT                   /db_xref="H-InvDB:HIT000218424.13"
FT                   /db_xref="HGNC:HGNC:6844"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:3ALN"
FT                   /db_xref="PDB:3ALO"
FT                   /db_xref="PDB:3VUT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45985"
FT                   /protein_id="AAC50127.1"
FT                   /translation="MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALK
FT                   LNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKD
FT                   LGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQ
FT                   FYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKEN
FT                   LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASR
FT                   QGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF
FT                   INFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
FT                   "
XX
SQ   Sequence 1310 BP; 396 A; 284 C; 305 G; 325 T; 0 other;
     tgggctcttc actcccaaca atggcggctc cgagcccgag cggcggcggc ggctccgggg        60
     gcggcagcgg cagcggcacc cccggccccg tagggtcccc ggcgccaggc cacccggccg       120
     tcagcagcat gcagggtaaa cgcaaagcac tgaagttgaa ttttgcaaat ccacctttca       180
     aatctacagc aaggtttact ctgaatccca atcctacagg agttcaaaac ccacacatag       240
     agagactgag aacacacagc attgagtcat caggaaaact gaagatctcc cctgaacaac       300
     actgggattt cactgcagag gacttgaaag accttggaga aattggacga ggagcttatg       360
     gttctgtcaa caaaatggtc cacaaaccaa gtgggcaaat aatggcagtt aaaagaattc       420
     ggtcaacagt ggatgaaaaa gaacaaaaac aacttcttat ggatttggat gtagtaatgc       480
     ggagtagtga ttgcccatac attgttcagt tttatggtgc actcttcaga gagggtgact       540
     gttggatctg tatggaactc atgtctacct cgtttgataa gttttacaaa tatgtatata       600
     gtgtattaga tgatgttatt ccagaagaaa ttttaggcaa aatcacttta gcaactgtga       660
     aagcactaaa ccacttaaaa gaaaacttga aaattattca cagagatatc aaaccttcca       720
     atattcttct ggacagaagt ggaaatatta agctctgtga cttcggcatc agtggacagc       780
     ttgtggactc tattgccaag acaagagatg ctggctgtag gccatacatg gcacctgaaa       840
     gaatagaccc aagcgcatca cgacaaggat atgatgtccg ctctgatgtc tggagtttgg       900
     ggatcacatt gtatgagttg gccacaggcc gatttcctta tccaaagtgg aatagtgtat       960
     ttgatcaact aacacaagtc gtgaaaggag atcctccgca gctgagtaat tctgaggaaa      1020
     gggaattctc cccgagtttc atcaactttg tcaacttgtg ccttacgaag gatgaatcca      1080
     aaaggccaaa gtataaagag cttctgaaac atccctttat tttgatgtat gaagaacgtg      1140
     ccgttgaggt cgcatgctat gtttgtaaaa tcctggatca aatgccagct actcccagct      1200
     ctcccatgta tgtcgattga tatcgctgct acatcagact ctagaaaaaa gggctgagag      1260
     gaagcaagac gtaaagaatt ttcatcccgt atcacagtgt ttttattgct                 1310
//

If you have problems or comments...

PBIL Back to PBIL home page