(data stored in ACNUC8465 zone)

EMBL: U18310

ID   U18310; SV 1; linear; mRNA; STD; MUS; 2292 BP.
XX
AC   U18310; S74764;
XX
DT   24-DEC-1995 (Rel. 46, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus protein kinase (SEK1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2292
RX   PUBMED; 7997269.
RA   Sanchez I., Hughes R.T., Mayer B.J., Yee K., Woodgett J.R., Avruch J.,
RA   Kyriakis J.M., Zon L.I.;
RT   "Role of SAPK/ERK kinase-1 in the stress-activated pathway regulating
RT   transcription factor c-Jun";
RL   Nature 372(6508):794-798(1994).
XX
RN   [2]
RP   1-2292
RA   Zon L.I.;
RT   ;
RL   Submitted (08-DEC-1994) to the INSDC.
RL   Leonard I. Zon, Hematology, Children's Hospital of Boston, HHMI, 300
RL   Longwood Ave., Boston, MA 02115, USA
XX
DR   MD5; 41fcf64f4d6c0726d0d982a51545c7d3.
DR   Ensembl-Gn; ENSMUSG00000033352; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018477; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018446; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018415; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018417; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018230; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018869; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017786; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018204; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018313; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018303; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018385; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018327; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018910; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017560; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017839; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000046963; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0029734; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0029688; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0029659; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0029679; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0029479; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0030178; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0029178; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0029395; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0029540; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0029510; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0029645; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0029496; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0030213; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0028884; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0028967; mus_musculus_wsbeij.
DR   EuropePMC; PMC23052; 10535984.
DR   EuropePMC; PMC3017503; 12788955.
XX
CC   On Feb 8, 2002 this sequence version replaced gi:786456 gi:1132416.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2292
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="36 hr embryo"
FT                   /tissue_type="total embryo"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        29..1222
FT                   /codon_start=1
FT                   /gene="SEK1"
FT                   /product="SEK1"
FT                   /function="protein kinase; regulates c-jun phosphorylation"
FT                   /db_xref="GOA:P47809"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1346869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47809"
FT                   /protein_id="AAB81554.1"
FT                   /translation="MAAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGKRKALKLN
FT                   FANPPVKSTARFTLNPNTTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLG
FT                   EIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFY
FT                   GALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLK
FT                   IIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQG
FT                   YDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFIN
FT                   FVNLCLTKDESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD"
XX
SQ   Sequence 2292 BP; 650 A; 521 C; 535 G; 586 T; 0 other;
     ctcgagatcc attgtgccta aagcaacaat ggcggctccg agcccgagcg gcggcggcgg        60
     ctccgggggc ggtggcggca ccccggggcc catcggacct ccagcttctg gccacccggc       120
     ggtcagcagc atgcagggta agcgcaaagc actgaagttg aattttgcaa atccacctgt       180
     caaatcgaca gcacggttta ccctgaatcc taatactaca ggagtccaga acccacacat       240
     agagagactg agaacacaca gcattgagtc atcaggaaaa ctgaagatct cccctgaaca       300
     acactgggat ttcactgcag aggacttgaa agaccttgga gaaattggac gaggagctta       360
     tggttctgtc aacaaaatgg tccacaaacc aagtgggcag ataatggcag ttaaaagaat       420
     tcggtcaact gtggatgaaa aagaacaaaa acaacttctc atggatttgg atgtagtaat       480
     gcggagtagt gattgcccat acattgttca gttctatggt gcactcttca gagagggcga       540
     ctgttggatc tgtatggagc tcatgtctac ctcgttcgat aagttttaca aatatgtata       600
     tagtgtgtta gatgacgtta ttccggaaga gatcttaggc aaaatcactt tagcaactgt       660
     gaaagcacta aaccacttaa aagaaaactt gaaaattatt cacagagaca tcaaaccttc       720
     caatattctt ctggacagaa gtggaaatat aaagctctgt gatttcggca tcagtggaca       780
     gcttgtggac tctattgcca agacaagaga tgctgggtgt aggccgtata tggcacctga       840
     aagaatagac ccaagtgcat caagacaagg gtatgatgtc cgctctgatg tctggagttt       900
     ggggatcaca ttgtacgagt tggccacagg ccgatttcct tatccaaagt ggaatagtgt       960
     atttgatcag ctaacacaag tggtgaaagg agaccctccg cagctgagta attctgaaga      1020
     aagggagttc tcccccagtt tcatcaactt tgtcaacttg tgccttacga aggatgaatc      1080
     caaaaggcca aagtataaag agcttctgaa acatcccttt attttgatgt atgaagaacg      1140
     tactgtagag gtcgcatgct atgtttgtaa aatcctggat cagatgccag ccactcccag      1200
     ctcgcccatg tatgtcgact gataccgctg ctacatcaga ctctagaaaa aagggctgag      1260
     gggaagcaag acgtaaagag ttttcatcct gtatcacagt gtttttattg ctcgcccaga      1320
     caccatgtgc aataagactg gtgttcgttt ccatcatgtc tgtatacttc tgtcatctag      1380
     actgtgcatc cctgtaatac ctgactgatc acagtgttag tgctggtcag agagacctca      1440
     tcctgctctt ttgtgatgaa catattcatg acgcgtggaa gtcagtacga tcaagttgtt      1500
     gactgtgatt agatcacacc ttaattcatt tctagactca aaacctggag acgcagctac      1560
     tggaatggtg ttttgtgaga cttccaaggc tggaaagaca cagtcatgga tgtactgtct      1620
     gagcatagag aacccgggct tgagtgagaa gagcttcaca gccagtgaga cacattgcct      1680
     tctgcagctg ggagacagag gaaggattcc ctttcttcac ccaaggtggc aatagatttc      1740
     ctcatctgat aggctgttgc tttaccgtca cacgcgatgt gcacagccaa attccctact      1800
     caaaatatca tgttaaatta gaatttatct ttaccaaaaa ccatgttgct ttcagagagg      1860
     tcaacattaa aatactgaga caggacagaa tgtgttcttt cgtccttttc cagcctgctc      1920
     ttctctggga agatacagga gtctgccacc tgtcatagaa gggtgctgcc aacttgatgc      1980
     tctacctgcc accaaccacc aggactgaag gaaggaaaca gtactgaggg caaagtttac      2040
     agatgttttt gattctggca ttttgtccag aacagcttgt agcagctata gattccccct      2100
     tggccccaag cctgggactt gagccatcgt aactcactaa cagggagaat tagctagtag      2160
     caatgtgcct tgatgaagat ttcctgcagg cagcaaaaca ccaatcacaa cgctttgctt      2220
     ctcgacatca tgggccaggt cctcagtttc taactctttc ccttccccct ttagagcaca      2280
     atggatctcg ag                                                          2292
//

If you have problems or comments...

PBIL Back to PBIL home page