(data stored in ACNUC1829 zone)

EMBL: AH004897

ID   AH004897; SV 2; linear; genomic DNA; STD; MUS; 2436 BP.
XX
AC   AH004897; U18367-U18372;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Mus musculus strain 129SV leukocyte surface antigen CD37 (Cd37) gene,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2436
RX   DOI; 10.1016/0161-5890(96)84612-8.
RX   PUBMED; 8845018.
RA   Tomlinson M.G., Wright M.D.;
RT   "Characterisation of mouse CD37: cDNA and genomic cloning";
RL   Mol. Immunol. 33(10):867-872(1996).
XX
RN   [2]
RP   1-2436
RA   Tomlinson M.G.;
RT   ;
RL   Submitted (12-DEC-1994) to the INSDC.
RL   Sir William Dunn School of Pathology, MRC, Cellular Immunology Unit, South
RL   Parks Road, Oxford, Oxfordshire, OX1 3RE, UK
XX
DR   MD5; f5d87c8fe001202ca0d8c6c1d4a176c9.
XX
CC   On or before Jun 10, 2016 this sequence version replaced gi:755235,
CC   gi:755236, gi:755237, gi:755238, gi:755239, gi:755240, gi:1668815.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2436
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="129SV"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /dev_stage="4-8 weeks"
FT                   /tissue_type="liver"
FT                   /note="in Stratagene Lambda FIX II vector"
FT                   /db_xref="taxon:10090"
FT   gene            57..2350
FT                   /gene="Cd37"
FT   CDS_pept        join(57..125,213..285,428..552,635..709,1031..1135,
FT                   1538..1774,2034..2117,2273..2350)
FT                   /codon_start=1
FT                   /gene="Cd37"
FT                   /product="leukocyte surface antigen CD37"
FT                   /protein_id="AAB39500.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVS
FT                   FVGLSFVPLQTWSKVLAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNK
FT                   AQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAK
FT                   AHIYREGCAQSLQKWLHNNIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR
FT                   "
FT   exon            <57..125
FT                   /gene="Cd37"
FT                   /product="leukocyte surface antigen CD37"
FT                   /number=1
FT   exon            213..285
FT                   /gene="Cd37"
FT                   /product="leukocyte surface antigen CD37"
FT                   /number=2
FT   gap             300..399
FT                   /estimated_length=unknown
FT   exon            428..552
FT                   /gene="Cd37"
FT                   /product="leukocyte surface antigen CD37"
FT                   /number=3
FT   exon            635..709
FT                   /gene="Cd37"
FT                   /product="leukocyte surface antigen CD37"
FT                   /number=4
FT   gap             782..881
FT                   /estimated_length=unknown
FT   exon            1031..1135
FT                   /gene="Cd37"
FT                   /product="leukocyte surface antigen CD37"
FT                   /number=5
FT   gap             1363..1462
FT                   /estimated_length=unknown
FT   exon            1538..1774
FT                   /gene="Cd37"
FT                   /product="leukocyte surface antigen CD37"
FT                   /number=6
FT   gap             1830..1929
FT                   /estimated_length=unknown
FT   exon            2034..2117
FT                   /gene="Cd37"
FT                   /product="leukocyte surface antigen CD37"
FT                   /number=7
FT   gap             2151..2250
FT                   /estimated_length=unknown
FT   exon            2273..>2350
FT                   /gene="Cd37"
FT                   /product="leukocyte surface antigen CD37"
FT                   /number=8
XX
SQ   Sequence 2436 BP; 363 A; 574 C; 525 G; 474 T; 500 other;
     ccaacacctc ttcctgtctg ggtttctcga gtgggtcatt ccccatctag gcgaagatgt        60
     ccgcccaaga gagttgcctc agcctcatca agtacttcct cttcgttttc aacctcttct       120
     tctttgtgag tctactcatg gctacccagc cggggtccca gggccacagt ggcccttgat       180
     ccgccctagc ctcatttctt ctcttcccct aggtactagg cggcctgatt ttctgcttcg       240
     gcacctggat cctcattgac aagaccagct tcgtgtcctt tgtgggtgag gggggctgcn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnc cactctcact gcttgtcacc       420
     acctcaggtt tgtccttcgt gccactgcag acttggtcca aggtcctggc tgtctcaggt       480
     gtcctcacca tggccctggc tctcctgggc tgtgtggggg ctctaaagga gctgcgctgt       540
     ctcctgggcc tggtgagtgg cattccccac ccccgtttcg ggccagcccc tgggagaccc       600
     aaggggctga actccccctc cactctgtcc tcagtatttt ggaatgctgc tgctcctgtt       660
     tgccacacag attaccctgg gcatcctcat ttctactcag cgggtccggg tgagtttact       720
     aacatcatta ccccaggctt ggaggttgag ggtctggcgc tgggagagag aaaggcaggt       780
     gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nagaaacact tctgagattc       900
     tgaggaagag agtcacttcc atcaggaaaa aaacccaaga gtggcaaagt tatggtcctg       960
     gggtgaacgc catgggaggt gtctggggta ggcagggtga ctgagcccag cctcatctac      1020
     atgctctcag ctggagcgaa gggtgcagga attggtgttg cggacgatcc agagctaccg      1080
     cacgaatccg gatgagacag cagccgagga gagttgggac tatgcacagt tccaggtgtg      1140
     tgagctcgtg tctcctgtct cacagtctcc tgtcgtctca aaaccgttag ttactattcc      1200
     ttaggctctg ggctctaacg tctcagcttc gccttgcgtg cctgtgggct gcaggtcaac      1260
     tatttcctca tccccacact tgccaaactg cttgagcagc cccaaatggc agcatttctg      1320
     ccctcttgta actaagttcc cagatcctag accctggggt tgnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnaggcatca tcgcaggcct ggctgcacac ctacaccggt      1500
     gacaacgggc ccctgactct gtccccttcc ccatcagctg cgctgctgcg gctggcaatc      1560
     tccgcgggac tggaacaagg cccagatgct gaaagcgaac gagtctgagg agccctttgt      1620
     gccctgctcc tgctacaact ccacggcgac caatgactcc accgtctttg ataagctctt      1680
     tttctcccag ctaagccggt tggggccgcg ggcgaagctg aggcagactg ctgacatatg      1740
     tgcactccct gcaaaagccc acatctaccg tgaggtggga ctagcggtag ccagtagctc      1800
     tggacgtgtg ggcctggggc tggatggggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1860
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1920
     nnnnnnnnna gacctgggtg gatatctagg cattgggtac ctaaaaaggg atccaagggt      1980
     tcccttggct taagggtgaa ttgcagaagc aacgccgtct tctgcttccc cagggctgcg      2040
     cgcagagcct ccagaagtgg ctgcacaaca atatcatctc catagtggga atctgtctgg      2100
     gagtcggtct tcttgaggtg acttgacccc gtccccatga gtgatttgtc nnnnnnnnnn      2160
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2220
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn tgaagcatct ccttttttcc agctcggctt      2280
     catgacgctc tcaatattcc tgtgtagaaa tctggatcac gtctatgacc ggctggcccg      2340
     gtaccgctag gccccagccc acccgtcggc acccacgcac ctccatgcag tcaggaaatg      2400
     tttccttcct ggttggtcac aggcttggag cccatg                                2436
//

If you have problems or comments...

PBIL Back to PBIL home page