(data stored in SCRATCH zone)

EMBL: U18532

ID   U18532; SV 1; linear; genomic DNA; STD; PRO; 2089 BP.
XX
AC   U18532;
XX
DT   01-JAN-1995 (Rel. 42, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Bacillus subtilis cytidine deaminase (cdd) gene and G-protein Bex (bex)
DE   gene, complete cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-2089
RA   Johnstone B.H., Torrance P.D., Maslesa-Galic S., Zarimani A.I.,
RA   Powell B.S., Court D.L., Simons R.W.;
RT   "Isolation and Characterization of a Bacillus subtilis G-Protein homologous
RT   to Eshcerichia coli Era";
RL   Unpublished.
XX
RN   [2]
RP   1-822
RX   DOI; 10.1007/BF00334391.
RX   PUBMED; 2526291.
RA   Song B.H., Neuhard J.;
RT   "Chromosomal location, cloning and nucleotide sequence of the Bacillus
RT   subtilis cdd gene encoding cytidine/deoxycytidine deaminase";
RL   Mol. Gen. Genet. 216(2-3):462-468(1989).
XX
RN   [3]
RP   1-2089
RA   Johnstone B.H.;
RT   ;
RL   Submitted (13-DEC-1994) to the INSDC.
RL   Brian H. Johnstone, Microbiology and Molecular Genetics, University of
RL   California at Los Angeles, Los Angeles, CA 90024, USA
XX
DR   MD5; 342f8731c811b0c723a6ddcb0355a15c.
DR   EuropePMC; PMC111427; 11073929.
DR   EuropePMC; PMC151948; 12399511.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2089
FT                   /organism="Bacillus subtilis"
FT                   /map="225 degrees"
FT                   /strain="W168"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="EcoRI partial digests of chromosomal DNA of 3
FT                   kb average insert size"
FT                   /clone="pBP17"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        112..522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdd"
FT                   /product="cytidine deaminase"
FT                   /db_xref="GOA:P19079"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="PDB:1JTK"
FT                   /db_xref="PDB:1UWZ"
FT                   /db_xref="PDB:1UX0"
FT                   /db_xref="PDB:1UX1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19079"
FT                   /protein_id="AAB59993.1"
FT                   /translation="MNRQELITEALKARDMAYAPYSKFQVGAALLTKDGKVYRGCNIEN
FT                   AAYSMCNCAERTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELCTKDVIVV
FT                   LTNLQGQIKEMTVEELLPGAFSSEDLHDERKL"
FT   misc_difference 348
FT                   /gene="cdd"
FT                   /replace="a"
FT                   /note="Differs from earlier sequence by Song and Neuhard,
FT                   GenBank Accession Number X17430"
FT                   /note="conflict"
FT                   /citation=[2]
FT   regulatory      492..496
FT                   /gene="cdd"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        503..1408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bex"
FT                   /standard_name="Bacillus Era Complementing Segment"
FT                   /product="Bex"
FT                   /note="similar to Era, an essential small G-protein in E.
FT                   coli of unknown function, Swiss-Prot Accession Number
FT                   P06616; bex was isolated by selecting for genomic clones
FT                   that complemented Era depletion in E. coli. Isolation was
FT                   performed by B. Powell who also developed the isolation
FT                   scheme"
FT                   /db_xref="GOA:P42182"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42182"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAB59994.1"
FT                   /translation="MTNESFKSGFVSIIGRPNVGKSTFLNRVIGQKIAIMSDKPQTTRN
FT                   KVQGVLTTGTSQTIFIDTPGIHKPKHKLGDFMMKVAQNTLKEVDLILFMINAEEGYGKG
FT                   DEFIIEKLQTMSTPVFLIVNKIDKIHPDQLLLLIDEYRKRYPFKEIVPISALEGNNIET
FT                   LLAQIEAYLPEGPQFYPSDQVTDHPERFIISELIREKVLHLTREEIPHSIAVAIESIKG
FT                   QDNGSVHVAATIVVERDSQKGIVIGKKGSLLKEVGKRARADIEALLGSRVYLELWVKVQ
FT                   KDWRNKMSQLRDFGFKEDEY"
FT   misc_difference 539^540
FT                   /gene="bex"
FT                   /replace="a"
FT                   /note="Differs from earlier sequence by Song and Neuhard,
FT                   GenBank Accession Number X17430"
FT                   /note="conflict"
FT                   /citation=[2]
FT   CDS_pept        1748..>2089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /note="orf3"
FT                   /db_xref="GOA:P42095"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42095"
FT                   /protein_id="AAB59995.1"
FT                   /translation="MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGAKKPNSR
FT                   LSAVSQPFLYGSFLMQKTSGLGTLQQGEMILSMRGIREDLFLTAYAAYVAELVDRGTEE
FT                   KKPNPYLFEF"
XX
SQ   Sequence 2089 BP; 674 A; 385 C; 498 G; 532 T; 0 other;
     gaattcttac atttatttta catttttaga aatgggcgtg aaaaaaagcg cgcgattatg        60
     taaaatataa agtgatagcg gtaccattat aggtaagaga ggaatgtaca catgaacaga       120
     caagaattaa taacagaagc tttaaaagcg cgtgatatgg catatgcgcc gtattccaaa       180
     ttccaagtag gagccgctct tcttaccaag gatggaaaag tgtacagagg ctgcaatatt       240
     gagaacgcgg catacagcat gtgcaattgc gccgagcgta ccgctttatt taaagctgtt       300
     tctgaagggg atacagagtt tcagatgctg gccgttgcgg ctgacacccc tggaccagta       360
     tctccgtgcg gagcctgccg acaggtgatt tctgagcttt gcacaaaaga cgttattgtc       420
     gtactgacta atttacaagg acaaataaaa gaaatgactg tggaagaatt attgccaggc       480
     gcattttcat cggaggattt acatgacgaa cgaaagcttt aaatcaggat ttgtatccat       540
     tattggaaga ccaaacgtag gaaaatctac atttttgaac agagtcattg gacaaaaaat       600
     cgcgatcatg agcgataagc cccaaacgac gagaaacaag gtgcaaggag tactgacgac       660
     aggcacatca caaaccattt ttattgacac accagggatt cataaaccta agcataaact       720
     tggggacttt atgatgaaag tggcgcaaaa tacattaaaa gaagtcgatt tgatcttgtt       780
     tatgatcaat gctgaggaag gctacgggaa gggcgacgaa ttcatcattg agaaattgca       840
     gacgatgtct acgcctgtat tcttaatcgt aaacaaaatt gataaaattc atcccgacca       900
     attgcttctg ctaattgacg aataccgcaa acgttatcct tttaaggaaa ttgttccgat       960
     ttctgcttta gaaggaaata acatcgaaac cttgctcgcg cagatcgaag cgtatttgcc      1020
     ggaagggccg caattctatc cgagtgacca ggtaactgac caccctgaac gatttatcat      1080
     ttctgaatta atcagggaaa aggtgctgca tttgacgaga gaagaaatcc cgcacagcat      1140
     tgcggtggcc atcgaatcca tcaaagggca ggacaacggt tctgtgcacg tagcggcaac      1200
     gattgtggtc gagcgggatt cccagaaagg catcgtgatc ggtaaaaaag gaagccttct      1260
     aaaagaggtt ggaaaaagag cgagagcgga tattgaagca ctgttgggct cccgtgtcta      1320
     ccttgaattg tgggtgaaag tgcagaaaga ctggcgtaat aaaatgtccc agcttcgcga      1380
     ttttggcttt aaagaggacg aatattaatc tcttcccgtg tgtgtcatta tctcacagga      1440
     acagggatac attagcaaat tttgtttaac atgaaatgga ggacatctgg tcaagataaa      1500
     ggtaagaatt tggagtttag gtaagctagt ttaactacag aaaggtgggt ttcttaggtg      1560
     ggtttcttgt gttgaatttt acctggaacg tattttctca aacaggaaat gttgatacgt      1620
     atcttctttt taaagaactg gaaaaagaga acatggaaag acccgaagaa ctagaagatg      1680
     agctagcccg atttgattat ccaattttat aaacctcttg gcgctcctgc ttgaggaagg      1740
     tgcggaaatg ctgacaaaat gtgaagggat cgttcttcgc acaaatgatt acggagagac      1800
     gaataaaatc gtaacattac tgacaagaga acacggaaaa ataggtgtta tggcacgagg      1860
     cgccaaaaaa ccgaacagcc gtttatcagc agtcagccag ccctttttgt atggttcttt      1920
     cttaatgcaa aaaacatcgg gcctcggaac gcttcagcag ggggaaatga tcctcagcat      1980
     gagaggcatc agggaagact tgtttttaac agcatatgct gcctatgttg ctgagttagt      2040
     cgacagaggc acagaagaaa aaaagccaaa tccttattta tttgaattc                  2089
//

If you have problems or comments...

PBIL Back to PBIL home page