(data stored in ACNUC15465 zone)

EMBL: U19144

ID   U19144; SV 1; linear; mRNA; STD; HUM; 552 BP.
XX
AC   U19144;
XX
DT   29-JUL-1995 (Rel. 44, Created)
DT   02-JUL-1999 (Rel. 60, Last updated, Version 3)
XX
DE   Human GAGE-3 protein mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-552
RX   DOI; 10.1084/jem.182.3.689.
RX   PUBMED; 7544395.
RA   Van den Eynde B., Peeters O., De Backer O., Gaugler B., Lucas S., Boon T.;
RT   "A new family of genes coding for an antigen recognized by autologous
RT   cytolytic T lymphocytes on a human melanoma";
RL   J. Exp. Med. 182(3):689-698(1995).
XX
RN   [2]
RP   1-552
RA   Van Den Eynde B.J.;
RT   ;
RL   Submitted (28-DEC-1994) to the INSDC.
RL   Benoit J Van Den Eynde, Ludwig Institute For Cancer Research, 74 Avenue
RL   Hippocrate, Brussels B-1200, Belgium
XX
DR   MD5; 399a50a1768f82cc250fcb69305eb821.
DR   EuropePMC; PMC2192160; 7544395.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..552
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /cell_line="MZ2-MEL.43"
FT                   /tissue_type="melanoma"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        100..456
FT                   /codon_start=1
FT                   /product="GAGE-3 protein"
FT                   /protein_id="AAA82746.1"
FT                   /translation="MNLSRGKSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEG
FT                   EPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPE
FT                   EVKTPEEGEKQSQC"
XX
SQ   Sequence 552 BP; 169 A; 119 C; 150 G; 114 T; 0 other;
     ctcatatttc acacagatga gttggcgagg aagatcgacc tattattggt ctaggccaat        60
     aataggtcga tcttcctcgc caactcatat ttcacacaga tgaatctcag tagaggaaaa       120
     tcgacctatt attggcctag accaaggcgc tatgtacagc ctcctgaagt gattgggcct       180
     atgcggcccg agcagttcag tgatgaagtg gaaccagcaa cacctgaaga aggggaacca       240
     gcaactcaac gtcaggatcc tgcagctgct caggagggag aggatgaggg agcatctgca       300
     ggtcaagggc cgaagcctga agctgatagc caggaacagg gtcacccaca gactgggtgt       360
     gagtgtgaag atggtcctga tgggcaggag atggacccgc caaatccaga ggaggtgaaa       420
     acgcctgaag aaggtgaaaa gcaatcacag tgttaaaaga aggcacgttg aaatgatgca       480
     ggctgctcct atgttggaaa tttgttcatt aaaattctcc caataaagct ttacagcctt       540
     ctgcaaagaa aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page