(data stored in ACNUC15465 zone)

EMBL: U19146

ID   U19146; SV 1; linear; mRNA; STD; HUM; 524 BP.
XX
AC   U19146;
XX
DT   29-JUL-1995 (Rel. 44, Created)
DT   02-JUL-1999 (Rel. 60, Last updated, Version 3)
XX
DE   Human GAGE-5 protein mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-524
RX   DOI; 10.1084/jem.182.3.689.
RX   PUBMED; 7544395.
RA   Van den Eynde B., Peeters O., De Backer O., Gaugler B., Lucas S., Boon T.;
RT   "A new family of genes coding for an antigen recognized by autologous
RT   cytolytic T lymphocytes on a human melanoma";
RL   J. Exp. Med. 182(3):689-698(1995).
XX
RN   [2]
RP   1-524
RA   Van Den Eynde B.J.;
RT   ;
RL   Submitted (28-DEC-1994) to the INSDC.
RL   BENOIT J VAN DEN EYNDE, Ludwig Institute for Cancer Research, 74 Avenue
RL   Hippocrate, Brussels B-1200, Belgium
XX
DR   MD5; 864378d5bedfbdbf71660912a949eef0.
DR   EuropePMC; PMC2192160; 7544395.
DR   EuropePMC; PMC2244258; 12463799.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..524
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /cell_line="MZ2-MEL.43"
FT                   /tissue_type="melanoma"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        75..428
FT                   /codon_start=1
FT                   /product="GAGE-5 protein"
FT                   /db_xref="GOA:Q13069"
FT                   /db_xref="H-InvDB:HIT000218497_06.4"
FT                   /db_xref="HGNC:HGNC:4102"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13069"
FT                   /protein_id="AAA82748.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEE
FT                   VKTPEEGEKQSQC"
XX
SQ   Sequence 524 BP; 148 A; 111 C; 154 G; 111 T; 0 other;
     agctgtgagg cagtgctgtg tggttcctgc cgtccggact ctttttcctc tactgagatt        60
     catctgtgtg aaatatgagt tggcgaggaa gatcgaccta ttattggcct agaccaaggc       120
     gctatgtaca gcctcctgaa gtgattgggc ctatgcggcc cgagcagttc agtgatgaag       180
     tggaaccagc aacacctgaa gaaggggaac cagcaactca acgtcaggat cctgcagctg       240
     ctcaggaggg agaggatgag ggagcatctg caggtcaagg gccgaagcct gaagctgata       300
     gccaggaaca gggtcaccca cagactgggt gtgagtgtga agatggtcct gatgggcagg       360
     agatggaccc gccaaatcca gaggaggtga aaacgcctga agaaggtgaa aagcaatcac       420
     agtgttaaaa gaaggcacgt tgaaatgatg caggctgctc ctatgttgga aatttgttca       480
     ttaaaattct cccaataaag ctttacagcc ttctgcaaag aaaa                        524
//

If you have problems or comments...

PBIL Back to PBIL home page