(data stored in ACNUC15465 zone)

EMBL: U19147

ID   U19147; SV 1; linear; mRNA; STD; HUM; 527 BP.
XX
AC   U19147;
XX
DT   29-JUL-1995 (Rel. 44, Created)
DT   02-JUL-1999 (Rel. 60, Last updated, Version 3)
XX
DE   Human GAGE-6 protein mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-527
RX   DOI; 10.1084/jem.182.3.689.
RX   PUBMED; 7544395.
RA   Van den Eynde B., Peeters O., De Backer O., Gaugler B., Lucas S., Boon T.;
RT   "A new family of genes coding for an antigen recognized by autologous
RT   cytolytic T lymphocytes on a human melanoma";
RL   J. Exp. Med. 182(3):689-698(1995).
XX
RN   [2]
RP   1-527
RA   Van Den Eynde B.J.;
RT   ;
RL   Submitted (28-DEC-1994) to the INSDC.
RL   BENOIT J VAN DEN EYNDE, Ludwig Institute for Cancer Research, 74 Avenue
RL   Hippocrate, Brussels B-1200, Belgium
XX
DR   MD5; 2d084c9d98d38fef24384ef53109de80.
DR   EuropePMC; PMC2192160; 7544395.
DR   EuropePMC; PMC2244258; 12463799.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..527
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /cell_line="MZ2-MEL.43"
FT                   /tissue_type="melanoma"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        82..435
FT                   /codon_start=1
FT                   /product="GAGE-6 protein"
FT                   /db_xref="H-InvDB:HIT000218498_08.4"
FT                   /db_xref="HGNC:HGNC:4103"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13070"
FT                   /protein_id="AAA82749.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEVDPPNPEE
FT                   VKTPEEGEKQSQC"
XX
SQ   Sequence 527 BP; 146 A; 113 C; 157 G; 111 T; 0 other;
     gccagggagc tgtgaggcag tgctgtgtgg ttcctgccgt ccggactctt tttcctctac        60
     tgagattcat ctgtgtgaaa tatgagttgg cgaggaagat cgacctatta ttggcctaga       120
     ccaaggcgct atgtacagcc tcctgaagtg attgggccta tgcggcccga gcagttcagt       180
     gatgaagtgg aaccagcaac acctgaagaa ggggaaccag caactcaacg tcaggatcct       240
     gcagctgctc aggagggaga ggatgaggga gcatctgcag gtcaagggcc gaagcctgaa       300
     gctgatagcc aggaacaggg tcacccacag actgggtgtg agtgtgaaga tggtcctgat       360
     gggcaggagg tggacccgcc aaatccagag gaggtgaaaa cgcctgaaga aggtgaaaag       420
     caatcacagt gttaaaagaa gacacgttga aatgatgcag gctgctccta tgttggaaat       480
     ttgttcatta aaattctccc aataaagctt tacagccttc tgcaaaa                     527
//

If you have problems or comments...

PBIL Back to PBIL home page