(data stored in ACNUC23119 zone)

EMBL: AH006036

ID   AH006036; SV 2; linear; genomic DNA; STD; HUM; 16921 BP.
XX
AC   AH006036; U19152-U19176;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens chromosome 15 P protein (P) and P protein, truncated (P)
DE   genes, complete cds.
XX
KW   OCA2; tyrosinase-positive oculocutaneous albinism.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1038/361072a0.
RX   PUBMED; 8421497.
RA   Rinchik E.M., Bultman S.J., Horsthemke B., Lee S.T., Strunk K.M.,
RA   Spritz R.A., Avidano K.M., Jong M.T., Nicholls R.D.;
RT   "A gene for the mouse pink-eyed dilution locus and for human type II
RT   oculocutaneous albinism";
RL   Nature 361(6407):72-76(1993).
XX
RN   [2]
RP   1-16921
RX   DOI; 10.1016/0888-7543(95)80220-G.
RX   PUBMED; 7601462.
RA   Lee S.T., Nicholls R.D., Jong M.T., Fukai K., Spritz R.A.;
RT   "Organization and sequence of the human P gene and identification of a new
RT   family of transport proteins";
RL   Genomics 26(2):354-363(1995).
XX
RN   [3]
RP   1-16921
RA   Spritz R.A.;
RT   ;
RL   Submitted (27-DEC-1994) to the INSDC.
RL   Richard A. Spritz, Medical Genetics, University of Wisconsin, 445 Henry
RL   Mall, Madison, WI 53706, USA
XX
DR   MD5; 3a18498ebb9e2e817dfc70c11d2f6699.
XX
CC   On or before Jun 10, 2016 this sequence version replaced gi:773301,
CC   gi:773302, gi:773303, gi:773304, gi:773305, gi:773306, gi:773307,
CC   gi:773308, gi:773309, gi:773310, gi:773311, gi:773312, gi:773313,
CC   gi:773314, gi:773315, gi:773316, gi:773317, gi:773318, gi:773319,
CC   gi:773320, gi:773321, gi:773322, gi:773323, gi:773324, gi:773325,
CC   gi:1173486.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..16921
FT                   /organism="Homo sapiens"
FT                   /chromosome="15"
FT                   /map="15q11.2-q12"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            189..16744
FT                   /gene="P"
FT   exon            189..285
FT                   /gene="P"
FT                   /number=1
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   5'UTR           189..>285
FT                   /gene="P"
FT   misc_feature    189
FT                   /gene="P"
FT                   /note="apparent mRNA 5' terminus"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            191..285
FT                   /gene="P"
FT                   /number=1
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   5'UTR           191..>285
FT                   /gene="P"
FT   misc_feature    191
FT                   /gene="P"
FT                   /note="apparent mRNA 5' terminus"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            192..285
FT                   /gene="P"
FT                   /number=1
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   5'UTR           192..>285
FT                   /gene="P"
FT   misc_feature    192
FT                   /gene="P"
FT                   /note="apparent mRNA 5' terminus"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            194..285
FT                   /gene="P"
FT                   /number=1
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   5'UTR           194..>285
FT                   /gene="P"
FT   misc_feature    194
FT                   /gene="P"
FT                   /note="apparent mRNA 5' terminus"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            195..285
FT                   /gene="P"
FT                   /number=1
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   5'UTR           195..>285
FT                   /gene="P"
FT   misc_feature    195
FT                   /gene="P"
FT                   /note="apparent mRNA 5' terminus"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            197..285
FT                   /gene="P"
FT                   /number=1
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   5'UTR           197..>285
FT                   /gene="P"
FT   misc_feature    197
FT                   /gene="P"
FT                   /note="apparent mRNA 5' terminus"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            198..285
FT                   /gene="P"
FT                   /number=1
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   5'UTR           198..>285
FT                   /gene="P"
FT   misc_feature    198
FT                   /gene="P"
FT                   /note="apparent mRNA 5' terminus"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             490..589
FT                   /estimated_length=unknown
FT   mRNA            join(778..1181,1713..1811,2300..2488,2978..3035,3645..3717,
FT                   4264..4424,4884..4966,5580..5733,6230..6301,6912..6977,
FT                   7481..7537,8259..8383,8768..8906,9298..9430,9985..10132,
FT                   10787..10844,11233..11341,12519..12646,13329..13388,
FT                   14030..14134,14788..14881,15559..15652,16159..16744)
FT                   /gene="P"
FT   exon            934..1181
FT                   /gene="P"
FT                   /number=2
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   5'UTR           <934..954
FT                   /gene="P"
FT   CDS_pept        join(955..1181,1713..1811,2300..2488,2978..3035,3645..3717,
FT                   4264..4424,4884..4966,5580..5733,6230..6301,6912..6977,
FT                   7481..7537,8259..8383,8768..8906,9298..9430,9985..10132,
FT                   10787..10844,11233..11341,12519..12646,13329..13388,
FT                   14030..14134,14788..14881,15559..15652,16159..16243)
FT                   /codon_start=1
FT                   /gene="P"
FT                   /product="P protein"
FT                   /function="melanocyte-specific transporter protein"
FT                   /protein_id="AAC13784.1"
FT                   /translation="MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGA
FT                   DPSHSCPRGAAGQSSWAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNS
FT                   LQEKGSRCIPVYHPEFITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPH
FT                   IRLRLSKLRRCVQWLKVMGLFAFVVLCSILFSLYPDQGKLWQLLALSPLENYSVNLSSH
FT                   VDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPR
FT                   RSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQYLRGSVETQVTIATAILAG
FT                   VYALIIFEIVHRTLAAMLGSLAALAALAVIGDRPSLTHVVEWIDFETLALLFGMMILVA
FT                   IFSETGFFDYCAVKAYRLSRGRVWAMIIMLCLIAAVLSAFLDNVTTMLLFTPVTIRLCE
FT                   VLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC
FT                   LVLLVCFPLLRLLYWNRKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRRLLL
FT                   GKVLALEHLLARRLHTFHRQISQEDKNWETNIQELQKKHRISDGILLAKCLTVLGFVIF
FT                   MFFLNSFVPGIHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFVLMEA
FT                   LAHLHLIEYVGEQTALLIKMVPEEQRLIAAIVLVVWVSALASSLIDNIPFTATMIPVLL
FT                   NLSHDPEVGLPAPPLMYALAFGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRL
FT                   GFPMMVVSCTVGMCYLLVAHVVVGWN"
FT   CDS_pept        join(955..1181,1713..1811,2300..2488,2978..3035,3645..3717,
FT                   4264..4424,4884..4966,5580..5733,6230..6301,6912..6977,
FT                   7481..7537,8259..8383,8768..8906,9298..9430,9985..10132,
FT                   10787..10844,11233..11341,11821..11876)
FT                   /codon_start=1
FT                   /gene="P"
FT                   /product="P protein, truncated"
FT                   /protein_id="AAC13783.1"
FT                   /translation="MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGA
FT                   DPSHSCPRGAAGQSSWAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNS
FT                   LQEKGSRCIPVYHPEFITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPH
FT                   IRLRLSKLRRCVQWLKVMGLFAFVVLCSILFSLYPDQGKLWQLLALSPLENYSVNLSSH
FT                   VDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPR
FT                   RSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQYLRGSVETQVTIATAILAG
FT                   VYALIIFEIVHRTLAAMLGSLAALAALAVIGDRPSLTHVVEWIDFETLALLFGMMILVA
FT                   IFSETGFFDYCAVKAYRLSRGRVWAMIIMLCLIAAVLSAFLDNVTTMLLFTPVTIRLCE
FT                   VLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC
FT                   LVLLVCFPLLRLLYWNRKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRRLLL
FT                   GKVLALEHLLARRLHTFHRQISQEDKNWETNIQELQKKHRISDGILLAKCLTVLGFVIF
FT                   MFFLNSFVPGIHLDLGGLGLVQAGRYYLSTPES"
FT   gap             1483..1582
FT                   /estimated_length=unknown
FT   exon            1713..1811
FT                   /gene="P"
FT                   /number=3
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             2022..2121
FT                   /estimated_length=unknown
FT   exon            2300..2488
FT                   /gene="P"
FT                   /number=4
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             2597..2696
FT                   /estimated_length=unknown
FT   exon            2978..3035
FT                   /gene="P"
FT                   /number=5
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             3379..3478
FT                   /estimated_length=unknown
FT   exon            3645..3717
FT                   /gene="P"
FT                   /number=6
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             3887..3986
FT                   /estimated_length=unknown
FT   exon            4264..4424
FT                   /gene="P"
FT                   /number=7
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             4557..4656
FT                   /estimated_length=unknown
FT   exon            4884..4966
FT                   /gene="P"
FT                   /number=8
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             5314..5413
FT                   /estimated_length=unknown
FT   exon            5580..5733
FT                   /gene="P"
FT                   /number=9
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             5926..6025
FT                   /estimated_length=unknown
FT   exon            6230..6301
FT                   /gene="P"
FT                   /number=10
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             6479..6578
FT                   /estimated_length=unknown
FT   exon            6912..6977
FT                   /gene="P"
FT                   /number=11
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             7298..7397
FT                   /estimated_length=unknown
FT   exon            7481..7537
FT                   /gene="P"
FT                   /number=12
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             7850..7949
FT                   /estimated_length=unknown
FT   exon            8259..8383
FT                   /gene="P"
FT                   /number=13
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             8577..8676
FT                   /estimated_length=unknown
FT   exon            8768..8906
FT                   /gene="P"
FT                   /number=14
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             9111..9210
FT                   /estimated_length=unknown
FT   exon            9298..9430
FT                   /gene="P"
FT                   /number=15
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             9646..9745
FT                   /estimated_length=unknown
FT   exon            9985..10132
FT                   /gene="P"
FT                   /number=16
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             10358..10457
FT                   /estimated_length=unknown
FT   exon            10787..10844
FT                   /gene="P"
FT                   /number=17
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             10971..11070
FT                   /estimated_length=unknown
FT   exon            11233..11341
FT                   /gene="P"
FT                   /number=18
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             11535..11634
FT                   /estimated_length=unknown
FT   exon            11821..11897
FT                   /gene="P"
FT                   /number=19
FT                   /note="alternatively spliced"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             12098..12197
FT                   /estimated_length=unknown
FT   exon            12519..12646
FT                   /gene="P"
FT                   /number=20
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             12857..12956
FT                   /estimated_length=unknown
FT   exon            13329..13388
FT                   /gene="P"
FT                   /number=21
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             13737..13836
FT                   /estimated_length=unknown
FT   exon            14030..14134
FT                   /gene="P"
FT                   /number=22
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             14429..14528
FT                   /estimated_length=unknown
FT   exon            14788..14881
FT                   /gene="P"
FT                   /number=23
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             15151..15250
FT                   /estimated_length=unknown
FT   exon            15559..15652
FT                   /gene="P"
FT                   /number=24
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             15935..16034
FT                   /estimated_length=unknown
FT   exon            16159..16744
FT                   /gene="P"
FT                   /number=25
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   3'UTR           16244..16744
FT                   /gene="P"
FT   polyA_site      16744
FT                   /gene="P"
XX
SQ   Sequence 16921 BP; 3508 A; 3307 C; 3620 G; 4086 T; 2400 other;
     gaattcatgc cgggggtgcg gaacgggcga gctgtgggcg gggccatgtg ggcagctttg        60
     tgggcgtggc cgggaggggc gtgctacggc gtggccgcac tgtgggcggg gccgagtggg       120
     gagtgctgtg ggcggggccg ggccgggggg gtgcctgggt ggggccgctg cgggagcgcc       180
     gagctccctc tgagttctta cttcgaaggc tgtgctccgc tcaccatcca gagcggaggt       240
     gcggacctta aactcactcc tggagaaaga tctgcaagtg cgcaggtaaa gtgcacgtgc       300
     tccgcggtcg ggaggccgga ggcgaggagc cagactagcc tgggaacagg cagggagggt       360
     ttacacagcc ccggctgagt cgcggcttag gacgcaaggc aagttcccct aaaggttagt       420
     gtgcacagac gggtgcgacg gagccgacct agcgcggctg agtccgcctg ggcctgcagc       480
     agctgccccn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnc cattttacag       600
     agtgctgatt gggtccactg tacagagtgc tgattggtcc attttataga ttgctgattg       660
     gtgcatttac aatcctctag ctagacacag agtgctgatt ggtgcattta caatccttta       720
     gctagacaga aatgttctgc aagttcccac tccacccagg aagtccagct ggcttcactt       780
     ctcactaggg tgaaatgctc ttgcatggtt aggatgctgg aactctggga ccgcctccga       840
     agaagcaacc ttcctattgt acggactccc aaggtgcaaa cgttagtctc agtgtgcctt       900
     tcatgaagag tggtttcttt ctggctgccc tagagagaag actggcagtg gagcatgcat       960
     ctggagggca gagacggcag gcggtacccc ggcgcgccgg cggtggagct cctgcagacg      1020
     tccgtgccca gcggactcgc tgaacttgtg gccggcaagc gcaggcttcc tcggggagcc      1080
     ggtggagctg acccctcgca ctcctgcccc aggggggctg ccgggcagag ctcttgggct      1140
     cctgcaggcc aggagtttgc ttcattcctc acaaaaggga ggtgagttta aaatagtgcc      1200
     atcttgtaaa tgtggacttc acacagattg ggtttccatg agcatcgttc ccccacgttt      1260
     gtagtgggaa aaatttccag aaattttgca agaatttttc cagcattaga tcactttcct      1320
     ggcttagttt ttgatgactg atatttgtaa aatatgatga acttaattta gctccaaaag      1380
     ataataaaaa tagaaaaaag agtttgtagc atgaagactt aacacttaat atattattta      1440
     aagtttgcaa ttattctgca attttggaaa gcgtatgtct ctnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nncccttagg caaatttcct tgtaagattt atcactgaat      1620
     cttggcacat tcttgaatct agcacctgag tgctgggaac acatacatta tttctgtgtt      1680
     ggtgattctg tttcctaccc tgtctctttc aggtctcact cttctttgcc ccagatgtcc      1740
     agctccaggt ctaaagattc ctgctttaca gaaaacactc ctttgctgag gaattcctta      1800
     caggagaaag ggtgagatat tttccccctc atatgaaagt aagagtttct gagcattgca      1860
     cctggcatgt atgctggaga acttgagaca cgaattttta ttggacatgt ttaacctctg      1920
     ccagatcctt gacaatttat tgtagtagat gttcatgatt ccggtggtta tattctgagg      1980
     atattaattt ccagatggcc ttgagcataa ccctgcagca annnnnnnnn nnnnnnnnnn      2040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nttctgagag gtcacaaaaa aacccattcc caccagtatg      2160
     agagtgcacc actgtctgtg gtcctttgaa agaccagggt tgattcggtg ccatttcaca      2220
     cagtcagaac tcagaggaaa gcttgctttg tagccattac tatttcagga gagataacca      2280
     cacctctctt gctttccagg tcacggtgca tacctgttta ccatccagag ttcatcactg      2340
     ctgaagagtc ttgggaagac agctctgctg actgggagcg aagatacctg ctaagcaggg      2400
     aggtgtctgg tctgtctgca tctgcctcct ccgagaaggg agaccttctg gacagcccgc      2460
     acatccgact ccgtctttcc aagctgaggt aggcggactt ggggtgccca ccctggcagc      2520
     agcggtggcc gcacatcgcg tcctacatgg cccctccatc tttcaaacca gcagcgtgaa      2580
     gaagaggatg agttttnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2640
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaaaa      2700
     agtctcaaat cttgaacttt agtttcccca acaacaagct atgtgcaaac actttggtta      2760
     actttgttct cctctggaac ctccaccatg ctcctttgga tggggctgtg ggtttactgg      2820
     tcactgatat gagggtgttc tccctcatat catgttatgg aaagaattca aaacacatgc      2880
     tttgagatgg aagttactca aggctgcaga aaagtgtctg agtctgggca acaggactgc      2940
     tgcccttgcc actaaggccc tactttttct cttgcaggcg ctgtgtgcag tggctgaaag      3000
     tcatgggcct gtttgccttt gtggtgctgt gttctgtgag taccttagct gccccagcac      3060
     tactgttggg tccgtggaag ccctgtgtgc ctttggctgt atagcagggg gaacctgagg      3120
     tgtggggctc agtgcctggc cctcttcgcc tgattctctg actgtctttg gaggagatgc      3180
     tgagggttgt ggggcagcgg gctgaggggg tcgaggccgc agctgtactc ctctgctgtg      3240
     gtcccagtca cacggcagaa gccgggcagc atgttgttgc catatggaag gtcgggatgc      3300
     tggctgtggg gctcccttcc ccctcgagtg gcttaccact tccctgttca gccctggaca      3360
     gtagcactct tcatgtgtnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnntc      3480
     agaatattat aatatttaag acaaagctat tcagagtaag tggcgcgtac tggatgcaca      3540
     cagtagcccc atcatcacat ctgttttcga ctgttatcaa aatgatttat accttactgc      3600
     tctcatacca cacctctgtc attcaacgtt tctgattgtt acagattttg ttcagcctat      3660
     atccggatca aggaaagctc tggcagctgt tggccttatc accgctggag aactactgta      3720
     tccaaaatcc actctgagat ggccagccgc ctggctgaga tctgaaacac aaggagacac      3780
     ttgcagacgg ttgtgactgc tgctgaaggc cacggcacag gccattacca ctcgaatttt      3840
     gtttctccag gatgtctgat gagagatgga gtctcaggac agagggnnnn nnnnnnnnnn      3900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3960
     nnnnnnnnnn nnnnnnnnnn nnnnnnagct aaggatgcac cctttccctg gtgtgggggg      4020
     cacctctcac aagagggtca cgacgatctg cttcagggga gttaggtctt gaatgagggc      4080
     tgagatgtgg gtaataagaa aggcaggaag atcgtgttaa tggccaaggg cgtggggcac      4140
     ctggggaaac acctggggaa acgcatttct tcacacactg tcagaggagg gtgtcgtctg      4200
     gcgggcggcg gggacatggg gtttctcctg tctgccttgt ggttctcctt gacactctcc      4260
     gagccgtgaa ccttagcagc cacgtggact ccacgctgct gcaggtggac ctggcagggg      4320
     ccctagtggc cagtgggccg agtcgtcctg ggagggaaga gcacatcgtg gtggagctga      4380
     cccaggctga cgctttgggc tccaggtggc ggcggccaca gcaggttatg ctgataattt      4440
     atttgaaagg aattgtgaaa tctcatttca tctcataata aattgtgttt cctcttgaat      4500
     ggatttaatg gggagccaca ggcgagcaca ccattcttag tcaattcatt ggctctnnnn      4560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnngaat cctttttctt aaacaaagct      4680
     ctctaaattg tggaaattcc cagctccaac cacctgcact agctcctaac atcagagatg      4740
     tgagagctca aataaagatg ctctcctgtt tctttctttc tccttttctt ttttgaaaca      4800
     aatacctaga ccgagcagtg ccagatccca gatggtgtct caggtgaaaa gcctcaccat      4860
     aacttatgct ttggcttgta caggtcactc acaactggac ggtgtattta aatccgagga      4920
     gaagcgagca ctcagtgatg agcaggacct ttgaggtact gaccaggtga gttctcagtg      4980
     agtgaggtgt tggggcaggc tctctgggac acgtgcgttt aaaggagtct gacctatagg      5040
     acactgattt cggcccacac agcaccaggt cagcatgtga cttggacacg gcactcatgc      5100
     tgtgtagaca gtaagctcaa aggctgtggg aggacatcgt agccatgggt gtcaggatgt      5160
     gagagggtcg actgcagaag tcactttgaa acaaatggta ttttttggtt gacgttctaa      5220
     tttcattaat gtgaagctgt acaatggaat tccaggaaat ttaggattct tcttccttaa      5280
     ctaatgctgc ttcatattca atcggtactc ttgnnnnnnn nnnnnnnnnn nnnnnnnnnn      5340
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5400
     nnnnnnnnnn nnncctatgt ctcacgcctg ctgcctgtgc tcactgctct tccagctgtg      5460
     atattgggcg ttgggctgaa ttgttccatt tggactctgg ttaattccat ggctgataca      5520
     gagggaggtc ccctaactgt tgaccttgtg aacagtaagg tcgttgtttc gttctgcaga      5580
     gagacggtgt ccatcagcat ccgggcctcc ctgcagcaga cccaggctgt ccctcttttg      5640
     atggctcatc agtacctccg cggaagtgta gaaacccagg tgaccatcgc gacggccatc      5700
     ctcgcgggcg tctacgcgct gatcatattt gaggtaactt tcacacctgc tcccccgatc      5760
     tgtctgggcc cacagtcagg gaggcttgag atccgtgaga cactctggat gggctcagtc      5820
     ctgactcctt aatcaaactg gactagtgtc atcattccta aagattagcg tgtccctctc      5880
     tctaggtaga aagggaacca tacaggaata tttgctgaat cttggnnnnn nnnnnnnnnn      5940
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6000
     nnnnnnnnnn nnnnnnnnnn nnnnncaagc agcttccctt agatggcacg ttggtggtag      6060
     ctgtatgtgt ctgtggggtg tccaggcctg aaacatcaag acccatgact tatcatttga      6120
     atagatgtgg tacagtggca gatatagacc ccctcatgac cacacagctt tcgtgtgtgc      6180
     taactccctc gtgcactgga acgcggtaat ttcctgtgct tctttccaga tcgtgcacag      6240
     aactctggcg gccatgctgg gttcccttgc agcactggca gcactggctg tgattggcga      6300
     tgtaagttgt cacagtccca atccctggct taccactcag tgggatgtca gctcaaagat      6360
     gttccaggat tcaggctttc gtggtttttt cactatttta tatgccacgt ccatgttttt      6420
     gcccaagaac catgctagag gtatgaacta acaagctaca gcattgaaga gtacttttnn      6480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnncc tgtcatctgg tctcagctac      6600
     ggcatctgca gagagcacat acagatctcc actcggatgt aaccaggggc cagtcccgcc      6660
     atgtgggagt gccagaggcg gggctagaaa aaactttatt actaaatgca tagatttgac      6720
     attatagatg ccctgggtca agactgtttt tcagcagcga tataatccaa cttcaaaggc      6780
     aagtggatgg tgagatttcc aaccctggcc cgcccactga gtgggtctgc agcagggggc      6840
     agcgcttcat taggctcatc actgggatgg cggcgcacgg attaattggc aaatttgtgc      6900
     tttgattgca gagacccagc ctgacccatg tggtggagtg gattgatttt gagacgctgg      6960
     ccctgctgtt tggcatggta attacagctc tccccgtggg actgggctcc acgctgcggt      7020
     aaccgggcct tctctggcct ccaccgctga gggtccttca ttatgttaaa gacacagcgc      7080
     ctagggcttg actgagaagt gttagtgcag gtctcatgaa tctcctgagg aggaatggaa      7140
     tggggctatg gttcgtgggc gggagttttt cagcccaagg cgtgtctgac gatgaagtca      7200
     tattgccatt tagaaaagct agcaattcaa agagttattt ccgttaaaat aaaaaaaatg      7260
     gactatccca aataaataaa ccatgtagga gtttcagnnn nnnnnnnnnn nnnnnnnnnn      7320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7380
     nnnnnnnnnn nnnnnnnaaa tgtgtaaggg atcatgctga tgtcgtttta atatggtggc      7440
     ctgctaaaag attatccttg tcttcttctt ttccccatag atgatcttag tagccatatt      7500
     ttcagaaacg ggatttttcg attattgtgc tgtaaaggta ggtatgatgt tgcatttaat      7560
     aattctatcc tgattaattt atatatgtat ttttctgaca ttatatattt aggaaacaaa      7620
     catttaaaac aaacattgaa aaattccatc cttcttttaa aggttgcttc tgcagggcag      7680
     ggtatacttg ctatgtcaag ttgtatggct ctgagcagca ccttcagctg tcagaaataa      7740
     atgaagaagg aggtcaagga aaagggtact caggttgaat cgttgtgtat tatttaaatt      7800
     gtctggtgag agctacacat caaaaattgt tttacatatt agagtatccn nnnnnnnnnn      7860
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7920
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnc cagaataccg atggcattac gggactgagg      7980
     gtcatcacct tgtgacaaat taaccatcac aggggctctg tgaaggaaga ggatcagagg      8040
     ggtgacagtg ctggctaggg aggatttaga atgtctagga acttcgatgg ccagcactgt      8100
     ctctatctcg gcccccctag gactccgtgg gtctatgtct taacccatgg ggtaatgtta      8160
     gtttggctcc ctgttcttaa agtcactaat gaaaggctgc ctctgttcta cgagcctgct      8220
     cactctggct tgtactctct ctgtgtgtgt gtggccaggc ataccggctc tcccggggac      8280
     gggtgtgggc catgatcatc atgctctgtc tcatcgcggc cgtcctctct gccttcttgg      8340
     acaacgtcac caccatgctc ctcttcacgc ctgtgaccat aaggtacgca aagcacctct      8400
     gccgtgggag ttgcggccag gttctggcag gcaggggctc tgcctgcact gcctggctcc      8460
     aggttccatt ctcaggtgca tgaaaaggag ggggcagttg agcccacagc tcactgcatt      8520
     ccagtccagc tcgtgtctgc tttgtgtgac tgcagtacat gctacaagca gtggggnnnn      8580
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      8640
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnncgag caagcgcctt aaaaatctct      8700
     gggttgcatg tgggcctttc acgatgtgta tagtgggact actttcattt tcttccattt      8760
     gtgacaggtt gtgtgaggtg ctcaaccttg atccaagaca agtcctgatt gcagaagtga      8820
     tcttcacaaa cattggagga gctgccactg ccatcgggga ccctccaaat gtcattattg      8880
     tttccaacca agagctgagg aagatggtac gtaccagcat gctagggttg cttccagtaa      8940
     acgcacacct ccacttagtt agagctctac ccacatggac gcctttgtta gaaatcaaga      9000
     tcatcacgcc acctcttcac agtaagtgct actgggcatc tcaagactgg gatgttaggt      9060
     gactggtcct tcaatcctag agttaactgg cttgaattga cttcatactc nnnnnnnnnn      9120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn gatcgaccca cctcggaaag tgctgggatt      9240
     acaggcgtga gccaccatgc ctgggctgcc atttcatttc cccttgttta tttccagggc      9300
     ctggactttg ccggattcac tgcacacatg ttcattggga tttgccttgt tctcctggtc      9360
     tgctttccgc tcctcagact cctttactgg aacagaaagc tttataacaa ggaacccagt      9420
     gagattgttg gtgagtacaa gtgcaacctc atgtaggctc agatttcatg accataatat      9480
     tgtttgttta ccaggagaag ttcttattag gaagtatctg ttgatgggtt gctggatgct      9540
     caataccagt gactctccac gtccaccttc tagtatacac tgttttcagg gctgctatca      9600
     tgagctgtgc ctctttagtt ttcgtgaagt gtactgtccc taaaannnnn nnnnnnnnnn      9660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9720
     nnnnnnnnnn nnnnnnnnnn nnnnnaacat gtggtgtttg gttttttgtc cttgcaattt      9780
     gtgataattt ttaaatgtcg gctttgtcgt ctgggctcca ttgcaatagc tcaggtgctg      9840
     agaagctctg ggtgaccctg ggctacctgc acgtctcgag tgtgtgtctg ctctgtcagg      9900
     catcgactgt gtggggaaca gaggagggtg ttgctgatat ctgaggtcat gggagaccca      9960
     agcttcgcct tcctttctct gcagaactga agcacgagat tcacgtctgg cgcctgactg     10020
     ctcagcgcat cagcccggcc agccgcgagg agacagctgt gcgccgcctg ctgctgggga     10080
     aggtgctggc actggagcac ctgctcgccc ggaggctgca caccttccac aggtaccggg     10140
     cggggtcctg ctcagactgt gcttggtgtg cagcagaaca ttccatgggc ctacaaaata     10200
     gcgacattag ctgtatacta atacgtgata tttaggtgac gcacactgtt aagctttata     10260
     gtacattcat ctaaccctca ctgagctttg cagggggtac acagccgagc tttaaggacc     10320
     aaagaaacaa caacaaaacc agaggctcag agaatttnnn nnnnnnnnnn nnnnnnnnnn     10380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     10440
     nnnnnnnnnn nnnnnnngga aaataaagag actgacggtc gctgccctcc tccatgcact     10500
     gctgcggggt tttgtgaagc ttcccctgcg caagctgtca catgtacctc ctcacacaca     10560
     ctcctttcat cattcaggtc attatatgta tttttttggg aaaatagaga gtgagcacct     10620
     tttccagcca acaaatgaag ccccaccggc cccccatgac tagtcctgcc agccaggctc     10680
     caagtcacag accgcgtcca ggcacgaagc gctggggact gctgctccgc gatctcaccg     10740
     cgcagcgtga ccagggaagt aatgagtctc ttcttttctc ttttagacag atctcacagg     10800
     aggacaaaaa ttgggagacc aatatccaag aactccaaaa aaaggtaccc agctttcttt     10860
     cctcagggat ttctgattca cttctccaag aagggagtga gtgatgcctt ttccttccct     10920
     cacgtgactg aatgccggtt tctcttttta tttctgtggt tatacacaaa nnnnnnnnnn     10980
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     11040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ggtttccttg taacacagta ctttgccatt     11100
     ttctttcaag ttcgagaggt tacatttttc atcctcgtga aatctgtcgt gattccagtt     11160
     gcgtaggtta tgacacgctg caggagtcag aaggttgtgc agagtaaatg agctgtggtt     11220
     tctctcttac agcataggat atctgacggg attctgctcg ccaaatgcct gacagtgttg     11280
     ggatttgtta tcttcatgtt tttcctcaat tcgtttgtcc ctggcattca tcttgatctt     11340
     ggtgagtcta atttagcttt ggttcatagg ctttgtcaca ttctggatgg gaaggtttca     11400
     gagcctgttc ccagacactg actttgccca caggcagccg ggctggtggg aggccagaga     11460
     gggctgagat ggagggtggg cagcctgccc tgggaagaag ggcgcctttc cttttggttt     11520
     cctgggcagg agggnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     11580
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnctggaa     11640
     accatcagac attcatgggc tagaagttgg tcttcctttt ctcttatgta aaaaagccgc     11700
     atttctagat tctcacacaa cacatgatgt atgtgctttt gactggagtt ccagctttgt     11760
     gttatgtatt tgcagcccct ccatttcttt ctcttgataa tctcaaatcc aacttgccag     11820
     gtggcctggg cttggttcaa gctggcaggt attatttatc cacacctgag agctgatctg     11880
     cttggaatcc tgatgaggta atgatccaaa gctggagtgg taacgatttt gtgaatttca     11940
     attgtatttg gtggattaca tctagaaatt gctgcagtgt aattattttt aattacacct     12000
     caggcctaat gtaattttaa cattagaaac cttaatgact acaagaatgt tacgtggtca     12060
     ccactggtaa ttaaacaaat ttaaaaaact agtgtttnnn nnnnnnnnnn nnnnnnnnnn     12120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     12180
     nnnnnnnnnn nnnnnnnaaa attaagccaa tctatagtga aagaaaagag atgaatggtt     12240
     tactgggagt gtgggggttg acaagaggag ctagaggagg gtacaagaac ataggcatga     12300
     ataaactgta gggtcaatgg gcatgttcat tatcttgatt acagtgttgg tttcatgagt     12360
     atacacataa ccaaatagaa attatatgca ttttacatat atgcggtttg tagtatgaca     12420
     attattcttg ataaagaaaa aggcaaccag aggttaaaga aatgaatcgg tgtgttaaca     12480
     gtggaactat atctctatgt ctatttactt attttcagga tggattgcta ttctgggtgc     12540
     catctggttg ctaattttag ctgatattca tgattttgag ataattctac acagagtgga     12600
     atgggcaacc cttctgtttt ttgcagcgct ctttgttctg atggaggtaa gattttagaa     12660
     cttttgccat atggcatttt acctgatttt tgtatttcat gttttatttg gtgaatgaag     12720
     aaagcctaca tctattaatc tttccttata ttctctaagt ggaaaacaat ggaggttgta     12780
     attggactat tttaagttaa ccagctttac cttagccact gagagatttc tgacagcact     12840
     gcgtatttgt ttttttnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     12900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaaaa     12960
     gaaattggaa atgcgacttt cttgaaagat ctatatggag tggtatttca ttatgtacga     13020
     ttgaacagta tctttataca caggtcttaa agagagtctt ccattcggat ttaaatttaa     13080
     catggacctt aactcaaatc aatgagggat ttctgccact gctgttggac tttttctcca     13140
     tgaatcttca ttgtgcatat atgatagtaa attatttata gactgtgtat ttgagtctga     13200
     tcttttataa gaagcaggaa tctgggccta ccttatgttc acgtcttttc attttcaaga     13260
     cttttttttt aaatcttgca tatattttcg gttctaaact gattctcacc acacatcctt     13320
     tcttctaggc attggcacat ctccacttaa tagaatatgt tggagaacaa actgctttgc     13380
     taataaaggt aaaataaatg ctataataga aggcactcca gccactgttc tttgattttg     13440
     tgaaaaaaat taaaaaaaaa aagcactctg gtaagaacag gtcccattaa ttatgtaaaa     13500
     aggcacagca gggaacctgt tctatcctgt gcagcccaga gatgaaggga gactttttcc     13560
     gaagaatatg taattacaga tgcctgctct tttgctttta gcctttattt aaagcctgtc     13620
     tgagaaggag tgggattgac accagcctca gtaaatgagt gctgcaggcg ccccagcccc     13680
     aggggtctgc cgggccatca ggtcaatgtg accagtgtgc gcagccacca catgggnnnn     13740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     13800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnntttg ctggtagaaa cccagcagag     13860
     gctcctggtg tgggtgtggc ccctggcttg cacacctatg tctgccttgg tctcgtgatg     13920
     ggtaagagga aggactaaca ccctcgggcc cctctgagtc tcgcggctgg tgggtctgac     13980
     cctaagtgca tgcgatggaa cactgcagct gctattgtcc tccttccaga tggtcccaga     14040
     ggagcagcgc ctcatagccg ccattgtcct ggtggtgtgg gtctcagccc tggcgtcgtc     14100
     cctgattgac aacatcccgt tcactgctac catggtgagt tgcacatgtc catgtcgagg     14160
     gctcaacttt agcctggaca tagcctgggg ctcacccacc cttcctaaga gcagaggatg     14220
     aagcctgccc ctctgctgca ctcacaggtg tagaggacga aagtgagcag agcccagggc     14280
     agctgggtgg ggagtgccga gagcccagac tgcaggctgg gagccgaggc tctgcagctg     14340
     ccgtggacag cacgtcctgg ggtgactggt gatctcgagg tcagccccac tgagagctgc     14400
     cacccctccc agaaaaggct gtgcttgcnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     14460
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     14520
     nnnnnnnncc ccgtataaga gccacaacag ctggcagggc tcaggaccag gaggaccagt     14580
     tggtggcagc tggcatcaaa gacatacaga tgagttcaaa ctcaagtttc tgtggattcc     14640
     aaagtctgct ttggtttctt tccacaaatc ttatgctcct tagagtttga atgctgagaa     14700
     agcatttgga ttttctaaat tggtcacagt atggcagctt ctctgagcgt ccatgggacg     14760
     tggcatcaat gtcctcttcc tccacagatt cccgtgctcc tgaacctgag ccacgaccct     14820
     gaggttggcc tgcccgcacc gccgctcatg tatgccctgg ccttcggtgc ttgcctggga     14880
     ggtaaggggc tgctgactgc atgggggtgg gggtgcacgc ccacactgtg gttcagccca     14940
     aagcaacagt tagtacgtat cagattaaaa gcaaatgaag gagagtctgg atgatttcct     15000
     gagtggacac acattattaa gctttgacag agcaattcca gagcaactcc gttccttccc     15060
     gttatctgca gagctgcccc cgacttcccg ggcccattgc ctaggcatga ctggttctga     15120
     tgcttcacag ctaatgtgtt ccgcagtgtg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     15180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     15240
     nnnnnnnnnn ttgtgttttt ctctgaaaga cagggccccc acagtcgact tgcccattct     15300
     ccttagcttt cctccacctg ttaaatacaa cagccatggc tcttatccat aaatgaatca     15360
     tggtatttgt aatcagtgag cttatttttt gcttgcttgc gtgtgtgtgt gtttccagat     15420
     atttacaaag cggtcacttt gactataaaa taataatcaa atcaaagcct gtgagatgat     15480
     ctaaatatta caaaccaaag agaacagaag cttaccacca agatgaactg ggattttgtt     15540
     tttaaatttt gactttaggc aacgggacac tgattggcgc gtcggcaaac gtcgtgtgtg     15600
     cagggattgc agaacagcat ggatatgggt tctccttcat ggaatttttc aggtactttt     15660
     aaattccctt taaattttct gttaaactgt ctagttccta agcttactta attaaaaaaa     15720
     taacacatta aactaaaata agcatatttt tagcaagtag agagactgtg gtgtagggga     15780
     gattagctca gaaaaaaaca cattaaaaat ttaggctggc ggctcacgcc tgtaatccta     15840
     gcactttggg agggcgagcg ggtggattgc ctgagctcag gcgtttgacg accagcctcg     15900
     ggcaacacgg tgaatccctt catggtgaaa cacannnnnn nnnnnnnnnn nnnnnnnnnn     15960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     16020
     nnnnnnnnnn nnnnaaaagg tagtggccat tgtgaaaatg caaaggtgct aaggccatgt     16080
     tctcatgagc tatgagtccg tatctcatga gcttatccag atttcagatg ccataactca     16140
     tttctctttg tatttcaggc tgggcttccc aatgatggtt gtgtcctgca ctgttgggat     16200
     gtgttatctc cttgtggctc atgtggtggt gggatggaat taatagacat ccatctattg     16260
     ctcgaagact aaaggaaact tcatccatca caacccatta gtcataaaac taccctgacc     16320
     ccactgtttg aagaagaaaa ggtgcttacc ctggagatgc tacagagaca cagtggaata     16380
     gaccttgaca ctaacactct aattcaagcg aatgttggaa caccatgacc tcctctgtgt     16440
     gtcctttctc cccaaggaca aaatgtagaa agatgtgaga taacttactc aagattcccc     16500
     tccagaaaaa tacgtatgtt taaaaaccct tcctgctata cataggaaaa gacacacatc     16560
     cacctaaaat tgactgtact gtttaactgt caattctcct gaggctaaac acagtttgtt     16620
     tttcttgtaa tcacttttca tgttaaaata atcagcattc aaattgtatg ctttctgaat     16680
     atagactttc tgggaaaagg tttactgctc gtaaggaaac attttatgta ttaaaataaa     16740
     ctgttccttg ataaaaggct ttggagtagt ttacattatg taaaattgca ttttatccat     16800
     ttatattttt ctctgcagtt ttaaagttat taattaaaag tccagaaatt tgacttgcag     16860
     aagatcatag gtatctttta aggatatctt acatatttaa cagcttagag taatgatttt     16920
     t                                                                     16921
//

If you have problems or comments...

PBIL Back to PBIL home page