(data stored in SCRATCH zone)

EMBL: U26259

ID   U26259; SV 1; linear; mRNA; STD; MUS; 5237 BP.
XX
AC   U26259;
XX
DT   31-MAY-1995 (Rel. 43, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus C2-H2 zinc finger protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5237
RA   Wu Y., Montoya G.D., Rubin S.E., Brodie S.G., Jenkins N., Williams T.M.;
RT   "A murine gene encoding a zinc finger protein with homologs ranging from
RT   drosophila to humans";
RL   Unpublished.
XX
RN   [2]
RP   1-5237
RA   Williams T.M.;
RT   ;
RL   Submitted (03-MAY-1995) to the INSDC.
RL   Thomas M. Williams, Pathology, University of New Mexico, Albuquerque, NM
RL   87131-5301, USA
XX
DR   MD5; 9424e3b0cf25827446acf8cfe78864ac.
DR   Ensembl-Gn; ENSMUSG00000024238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025081; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5237
FT                   /organism="Mus musculus"
FT                   /chromosome="18"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda gt10"
FT                   /clone="YW-12, YW-13, YW-17/2, YW-24"
FT                   /cell_type="EL4 T cell"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..36
FT   CDS_pept        37..3390
FT                   /codon_start=1
FT                   /product="C2-H2 zinc finger protein"
FT                   /db_xref="GOA:Q64318"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR008598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1344313"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64318"
FT                   /protein_id="AAA67564.1"
FT                   /translation="MADGPRCKRRKQANPRRNNVTNYNTVVEANSDSDDEDKLHIVEEE
FT                   SITDAADCEGGMPDDELPADQTVLPGGSDRGGGAKNCWQDNVKDNECDSDAENEQNHDP
FT                   NVEEFLQQQDTAVIYPEAPEEDQRQGTPEASSHDENGTPDAFSQLLTCPYCDRGYKRFT
FT                   SLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRKFKC
FT                   TECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPVNGR
FT                   PRSGLKTSQCSSPSLSTSPGSPTRPQIRQKIENKPLQEPLSVNQIKTEPVDYEFKPIVV
FT                   ASGINCSTPLQNGVFSSGGQLQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVA
FT                   VDGNVIRQVLETNQASLASKEQEAVSASPIQQGGHSVISAISLPLVDQDGTTKIIINYS
FT                   LEQPSQLQVVPQNLKKEIPAPTNSCKSEKLPEDLTVKSETDKSFEGARDDSTCLLCEDC
FT                   PGDLNALPELKHYDPECPAQPPPPAPATEKPESSASSAGNGDLSPSQPPLKNLLSLLKA
FT                   YYALNAQPSTEELSKIADSVNLPLDGVKKWFEKMQAGQIPGQSPDPPSPGTGSVNIPTK
FT                   TDEQPQPADGNEPQEDSTRGQSPVKIRSSPVLPVGSAMNGSRSCTSSPSPLNLCSARNP
FT                   QGYSCVAEGAQEEPQVEPLDLSLPKQQGELLERSTVSSVYQNSVYSVQEEPLNLSCAKK
FT                   EPQKDSCVTDSEPVVNVVPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQ
FT                   TILIPQVAYTYSATVSPAVQEPPVKVIQPNGNQDERQDTSSEGVSTVEDQNDSDSTPPK
FT                   KKTRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICRKAFKHKHHLIEHMR
FT                   LHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKRGAEDRDAMEQEDAGPEVLPEVLA
FT                   TEHVGARASPSQADSDERESLTREEDEDSEKEEEEEDKEMEELQEGKECENPQGEEEEE
FT                   EEEEEEEEEEEEEEVEADEAEHEAAAKTDGTVEVGAAQQAGSLEQKASESEMESESESE
FT                   QLSEEKTNEA"
FT   3'UTR           3391..5237
FT   polyA_signal    5216..5221
XX
SQ   Sequence 5237 BP; 1557 A; 1184 C; 1230 G; 1266 T; 0 other;
     aggtgactcg agcatttaga cacaagcgag aggatcatgg cggatggccc caggtgtaag        60
     cgcagaaagc aggcgaaccc gcggcgcaat aacgttacaa attataatac tgtggtagaa       120
     gcaaattcag attccgatga tgaagacaaa ctccatattg tggaagaaga aagtattaca       180
     gatgcagctg actgtgaagg tggcatgcca gatgatgaac tgccagcaga ccagacagta       240
     ttaccaggag gcagtgacag ggggggcggt gccaagaact gctggcaaga caacgtgaaa       300
     gacaacgagt gtgactcaga tgcagaaaat gagcaaaacc atgatccgaa tgtggaagaa       360
     tttctgcagc aacaagacac cgccgtcatt tatcctgagg cgcccgagga agaccagcgg       420
     cagggcacac cagaagccag cagtcatgat gaaaacggaa caccagatgc attttcccag       480
     ttgctcacct gcccgtattg tgatagaggc tacaagcgct ttacctcttt gaaagaacac       540
     attaagtacc gccatgagaa gaacgaggac aacttcagct gctccctgtg cagttacacc       600
     tttgcataca gaacccagct tgaacgtcat atgacatcac ataagtcagg aagagagcaa       660
     agacatgtga cacagtctgg gggaaaccgc aagttcaagt gcactgaatg cgggaaggcc       720
     ttcaagtaca aacaccacct gaaagagcac ttacggattc acagtggaga gaagccatac       780
     gaatgcccga actgcaagaa acggttttcc cattctggct cctatagctc acatataagc       840
     agtaagaagt gtattagctt gatgcctgtg aatggcaggc ctagatcagg actcaagaca       900
     tctcagtgtt cctcgccatc tctttcgaca tcaccaggca gtcccacacg cccacagata       960
     cgacagaaga tagagaataa accccttcaa gaaccgcttt ctgtaaacca aatcaaaact      1020
     gaacctgtgg attatgagtt caaacccata gtggttgctt caggaatcaa ctgttcaacc      1080
     cctttacaaa atggggtttt tagcagtggt ggccaattgc aggcaaccag ttctcctcag      1140
     ggtgtggtgc aagccgttgt tctgccaaca gttggtttgg tatctcccat aagtatcaac      1200
     ttaagtgaca ttcagaatgt acttaaagtg gctgtagatg gtaacgtaat acgacaagtc      1260
     ttggagacta atcaagccag tcttgcatcc aaagagcaag aagcagtgag tgcttcgccc      1320
     atccagcagg gtggccattc tgtcatttct gccatcagtc ttcctttagt tgatcaggat      1380
     ggaacaacca aaatcatcat caactacagt cttgagcagc ccagtcaact tcaggttgtt      1440
     ccccagaatt taaagaaaga aatcccagcc cctacaaaca gctgcaaaag tgagaagtta      1500
     ccagaagacc ttactgtcaa atcagaaacg gacaaaagct ttgagggggc cagggatgat      1560
     agcacttgcc ttctgtgtga ggactgccca ggggacctca atgcacttcc agaactaaag      1620
     cactatgacc cagagtgccc tgctcagcct ccaccccctg ccccagccac cgagaagcca      1680
     gagtcctctg cttcatcagc tggaaacgga gatttgtctc ccagtcagcc acctttaaag      1740
     aaccttctgt cactcttgaa agcctactat gctctgaacg cgcagccaag cacagaagag      1800
     ctctcaaaga tcgccgattc tgtgaaccta ccgctggatg gagttaaaaa gtggtttgaa      1860
     aagatgcaag ctggacagat tccaggacag tctcctgacc ccccttctcc tggaaccggg      1920
     tcagtaaaca tacctacaaa aaccgatgag cagcctcaac ctgcggatgg aaatgagccc      1980
     caggaagaca gcacacgcgg acagagtcct gtcaagataa ggagctctcc ggttttacct      2040
     gtaggatcag ccatgaacgg ttccagaagc tgcacatcat ccccatcccc tctaaacctt      2100
     tgctcagcca ggaacccgca gggttactct tgtgtggcag agggtgccca ggaggagccc      2160
     caagtagaac ctcttgatct ctcactacca aagcaacagg gagagttact ggaaaggtcg      2220
     acagtcagta gcgtttacca gaacagtgtt tattctgtcc aggaagaacc cttgaacttg      2280
     tcttgtgcaa aaaaggaacc acaaaaggac agctgtgtta cagactcaga accagttgta      2340
     aatgtagtcc caccaagtgc caaccccata aacattgcta ttcctacagt cactgcccag      2400
     ttacccacaa tcgtggccat tgctgaccag aacagtgttc catgtttaag agcactggcc      2460
     gccaacaagc agactattct gattccccaa gtggcatata catattcagc tactgtgagc      2520
     cctgccgtgc aggagccgcc agtgaaggtg atccagccaa acggaaacca ggatgaaaga      2580
     caagacacta gctcagaagg agtctccact gtggaggacc agaatgactc tgactccacg      2640
     ccacccaaaa agaaaactcg gaagacagag aatggaatgt atgcatgtga cctgtgtgac      2700
     aagatatttc agaagagcag ctcactgttg agacacaaat atgagcacac aggtaagagg      2760
     cctcacgagt gtggaatctg tagaaaggca tttaaacaca agcatcattt gattgagcac      2820
     atgcggctgc actctgggga aaagccctat caatgtgaca agtgtggcaa gcgcttctca      2880
     cactccggct cctactctca acatatgaat caccgctact cctactgcaa gagaggagct      2940
     gaagacagag atgctatgga gcaggaagac gctgggcccg aagtcctgcc ggaagtcctg      3000
     gcgactgagc atgttggtgc ccgggcgtct ccctcacagg ctgactcgga cgagagagaa      3060
     agtctgacaa gggaagaaga tgaagacagt gaaaaggagg aggaggagga agataaagag      3120
     atggaagaat tacaggaagg aaaggaatgt gagaacccac agggggagga ggaggaggag      3180
     gaggaggagg aagaggagga agaagaggag gaagaggagg aagtggaagc ggatgaagcc      3240
     gagcatgagg cagcagccaa gactgatggt acagtggagg ttggagctgc acagcaggca      3300
     ggcagcttag agcagaaggc cagcgagagc gagatggaga gcgaaagcga gagtgagcag      3360
     ctgtctgaag agaagacaaa tgaagcttag gagttcttct aaaaggaaat tctacttggt      3420
     aatgaaattt gctctatatt acccacgctt ttcatggaaa catggctcca tggctcctgt      3480
     gctatggttc ctgctcacta ctgtgtaatg tcagaactga aaaaaaaaaa aaattccggg      3540
     tgtgcctgaa cctcaaacct agtaattttt catgcagttt tcaaagttag gaacaaattt      3600
     ataacatgaa gcagcttaga aaacattaat gactcagaaa acaaaggttt ctcagcaggt      3660
     tacaggaggc tggatgggcg tccggcatgg ctagcagtat tatcactctt acgttggctc      3720
     attcttaagc tctacaatgg gagaaatttt ataatttttt tattggtaaa catatgctaa      3780
     atccgcttca gtattttatt atgtttttta aaatgtgaga acttctgcac tacagaattc      3840
     ccttcacaga gcagtagaaa gcagttcaaa ccgtgctggc tacctgctgc tacccagtca      3900
     gtcaggagat aggacctctg acgttagatg ccgtgttgcc atctaacatg tattgctagc      3960
     cttaaggaag cagccagaga agagctggag tttcttactc gtgtgatttt taaatggagt      4020
     tcaaaggttg tcgttgagtc ctgactccag ggacgaccag tgttgatgtg gcaaggccgg      4080
     cagaggcggc agaatcagtg ttcgtgattg tttgcgtacg ttagcaacca tgaaggatct      4140
     ataggaagca agcgctgtgt ccctttggcc ttaagcaaga cctgtgctct aagtgccatt      4200
     ctcagtattg caaggctctg acagccttcc cgcagtgtgg cctatattaa ctagcagttg      4260
     ttgattcgtt tgttgtgtca aaattcccaa acaaaactca aaaccactga ctgtgagaga      4320
     agctgaagca ctggggcatc tcacactttt gttcctcagt agtcatttca tgttgattga      4380
     ctctcagaag tctctacaga aataaaaggg aaattctcca aactacttaa tccatgtact      4440
     tgcgtgtcag gcatggatac gctattggtt tttggttcac agccgttttc caaatgttag      4500
     ttattacgga cccaggtgat gaacaacagc agctgatttt tacctaccag tattatttta      4560
     tttcttttag tttatagatc tgtgcaacat ttttgtactg tatgtcttta agcctggcag      4620
     tattaatacc cttcttactg acacgtactt ttagttttag aaaaactttt atatttatgt      4680
     gtcttatttt tatatttctt tatttattac acagtgtagt gtataatact gtagtttgta      4740
     ttaatacaat aatatatttt agtatgaaat tttggaaagt tgctaagatt tacagtagag      4800
     atgcagttgg ttcccgtgcg ttgagatttg atttaacagt gttctgttaa catttatact      4860
     tgcctccgac tgtagaccag cctttaaatg ggaaggtatt agttttacaa ctacaatcaa      4920
     gtcattctcc ctttccccag tttttaatag gaaactctta cactttgaca ctcactgtgt      4980
     gcgactcata gcatgccgct ctgcagtctt ctgttaagag ttggcccagc cataactcat      5040
     tcccttagca agccaaatta gaattgcctt ctgtaaacag tgttgggaac aatgtttaac      5100
     atgtgccaat ttgttcctgt atccatgtat gtaagctacc aatctgactc ttccttttaa      5160
     gttccttgtt acaccatggt cattttctag ttttttacca gactccccag ctcacaataa      5220
     acgcatcaac aaacctg                                                     5237
//

If you have problems or comments...

PBIL Back to PBIL home page