(data stored in SCRATCH zone)

EMBL: U29084

ID   U29084; SV 1; linear; genomic DNA; STD; PRO; 5211 BP.
XX
AC   U29084;
XX
DT   04-JUL-1995 (Rel. 44, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Bacillus subtilis (mmgA), (mmgB), (mmgC), and citrate synthase III (mmgD)
DE   genes, complete cds, and (mmgE) gene, partial cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-5211
RX   PUBMED; 8759838.
RA   Bryan E.M., Beall B.W., Moran C.P.Jr.;
RT   "A sigma E dependent operon subject to catabolite repression during
RT   sporulation in Bacillus subtilis";
RL   J. Bacteriol. 178(16):4778-4786(1996).
XX
RN   [2]
RP   1-5211
RA   Bryan E.M.;
RT   ;
RL   Submitted (12-JUN-1995) to the INSDC.
RL   Edward M. Bryan, Department of Microbiology and Immunology, Emory
RL   University School of Medicine, 1510 Clifton Road, Atlanta, GA 30322, USA
XX
DR   MD5; 0529777fde4de716354a1e47e0144f9d.
DR   GOA; P54527.
DR   InterPro; IPR017946; PLC-like_Pdiesterase_TIM-brl.
DR   InterPro; IPR030395; GP_PDE_dom.
DR   UniProtKB/Swiss-Prot; P54527; YQIK_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5211
FT                   /organism="Bacillus subtilis"
FT                   /map="212 degrees"
FT                   /strain="MB24"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      154..181
FT                   /regulatory_class="terminator"
FT   regulatory      194..197
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      211..216
FT                   /regulatory_class="minus_10_signal"
FT   gene            262..1456
FT                   /gene="mmgA"
FT   regulatory      262..268
FT                   /gene="mmgA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        275..1456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgA"
FT                   /note="similar to Alcaligenes eutrophus acetyl-CoA
FT                   C-acetyltransferase, Swiss-Prot Accession Number P14611"
FT                   /db_xref="GOA:P45855"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="PDB:5LP7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45855"
FT                   /protein_id="AAB09613.1"
FT                   /translation="MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQQAGVSG
FT                   DDVEGNVMGMVVQAGSGQIPSRLAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRA
FT                   QDADILVAGGMESMSNIPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAVHGNT
FT                   AAKEYAISRREQDEWALRSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVDKDEAIRR
FT                   DTSLDQLAKLAPIYASDGSITAGNAPGVNDGAGAFVLMSEEKAAELGKRPLATILGFST
FT                   TGMPAHELAAAPGFAINKLLKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNV
FT                   NGGAIALGHPIGASGARILMTLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH"
FT   gene            1470..2344
FT                   /gene="mmgB"
FT   regulatory      1470..1476
FT                   /gene="mmgB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1481..2344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgB"
FT                   /note="similar to Clostridium acetobutylicum NAD-dependent
FT                   beta-hydroxybutyrl-CoA dehydrogenase, PIR Accession Number
FT                   A43723"
FT                   /db_xref="GOA:P45856"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45856"
FT                   /protein_id="AAB09614.1"
FT                   /translation="MEIKQIMVAGAGQMGSGIAQTAADAGFYVRMYDVNPEAAEAGLKR
FT                   LKKQLARDAEKGKRTETEVKSVINRISISQTLEEAEHADIVIEAIAENMAAKTEMFKTL
FT                   DRICPPHTILASNTSSLPITEIAAVTNRPQRVIGMHFMNPVPVMKLVEVIRGLATSEET
FT                   ALDVMALAEKMGKTAVEVNDFPGFVSNRVLLPMINEAIYCVYEGVAKPEAIDEVMKLGM
FT                   NHPMGPLALADFIGLDTCLSIMEVLHSGLGDSKYRPCPLLRKYVKAGWLGKKSGRGFYD
FT                   YEEKTS"
FT   regulatory      2359..2364
FT                   /gene="mmgC"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            2359..3511
FT                   /gene="mmgC"
FT   CDS_pept        2372..3511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgC"
FT                   /note="similar to product encoded by Bacillus subtilis
FT                   short chain acyl-CoA dehydrogenase gene, GenBank Accession
FT                   Number Z49782"
FT                   /db_xref="GOA:P45857"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="PDB:5LNX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45857"
FT                   /protein_id="AAB09615.1"
FT                   /translation="MHVTQEQVMMRKMVRDFARKEIAPAAEIMEKTDEFPFQLIKKMGK
FT                   HGLMGIPVPEQYGGAGADVVSYILAIHEISRISAAVGVILSVHTSVGTNPIMYFGNEEQ
FT                   KMKYIPNLASGDHLGAFALTEPHSGSDAGSLRTTAIKKNGKYLLNGSKIFITNGGAADI
FT                   YITFALTDPDQGRHGISAFIVEKNTPGFTVGKKERKLGLYGSNTTELIFDNAEVPEANL
FT                   LGKEGDGFHIAMANLNVGRIGIAAQALGIAEAALEHAVDYAKQRVQFGRPIAANQGISF
FT                   KLADMATRAEAARHLVYHAADLHNRGLNCGKEASMAKQFASDAAVKAALDAVQIYGGYG
FT                   YMKDYPVERLLRDAKVTQIYEGTNEIQRLIISKYLLGGT"
FT   regulatory      3532..3537
FT                   /gene="mmgD"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            3532..4663
FT                   /gene="mmgD"
FT   CDS_pept        3545..4663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgD"
FT                   /product="citrate synthase III"
FT                   /db_xref="GOA:P45858"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45858"
FT                   /protein_id="AAB09616.1"
FT                   /translation="MEEKQHYSPGLDGVIAAETHISYLDTQSSQILIRGYDLIELSETK
FT                   SYLELVHLLLEGRLPEESEMETLERKINSASSLPADHLRLLELLPEDTHPMDGLRTGLS
FT                   ALAGYDRQIDDRSPSANKERAYQLLGKMPALTAASYRIINKKEPILPLQTLSYSANFLY
FT                   MMTGKLPSSLEEQIFDRSLVLYSEHEMPNSTFAARVIASTHSDLYGALTGAVASLKGNL
FT                   HGGANEAVMYLLLEAKTTSDFEQLLQTKLKRKEKIMGFGHRVYMKKMDPRALMMKEALQ
FT                   QLCDKAGDHRLYEMCEAGERLMEKEKGLYPNLDYYAAPVYWMLGIPIPLYTPIFFSART
FT                   SGLCAHVIEQHANNRLFRPRVSYMGPRYQTKS"
FT   regulatory      4665..4671
FT                   /gene="mmgE"
FT                   /regulatory_class="ribosome_binding_site"
FT   gene            4665..5211
FT                   /gene="mmgE"
FT   CDS_pept        4678..>5211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgE"
FT                   /db_xref="GOA:P45859"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="PDB:5MUX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45859"
FT                   /protein_id="AAB09617.1"
FT                   /translation="MPKTDRVIEEITDYVLEKEITSAEAYTTAGHVLLDTLGCGILALR
FT                   YPECTKLLGPIVPGTTVPNGSKVPGTSYVLDPVRAAFNIGCMIRWLDYNDTWLAAEWGH
FT                   PSDNLGGILAAADYVSRVRLSEGKEPLTVRDVLEMMIKAHEIQGVLALENSLNRVGLDH
FT                   VLFVKVATTAVAAKL"
XX
SQ   Sequence 5211 BP; 1429 A; 1086 C; 1441 G; 1255 T; 0 other;
     actgaagaaa atgaggaacg gtttgattaa ggtaaggccg tatacagtca atcgtccgga        60
     agatatgaag cgtctcattg aagcgggagc agacggcatg tttaccgact ttccagaaaa       120
     ggcttcggca ttgctgaaaa atgaatagtt gttagaagga ggctgtttga cgcgaccttc       180
     ttttttcatt cattcatgcc cgtttcaaag catacattca tagaagacaa ctagaaattg       240
     taagcgctgt ctatcttctg aatgaggtga aaccatgagg aaaacagtca ttgtaagtgc       300
     tgcaagaact ccatttggca aattcggcgg agttttgaaa gaggtgaaag ctgctgagct       360
     tgggggcatt gtgatgaagg aggcgctgca acaggctgga gtctctggag atgatgtaga       420
     aggaaacgtc atgggcatgg ttgtccaggc cggctcaggg cagatacctt cccgtcttgc       480
     tgcccgtctg gcgggaatgc cttggagtgt gccgtcagaa acactgaata aagtctgtgc       540
     ttccggcctt cgcgctgtca ctttatgtga tcaaatgatt cgggcgcagg atgcggacat       600
     acttgttgcg ggggggatgg aaagcatgag caatattccg tatgccgttc ccgccgggcg       660
     ctggggagca cggatggggg acggcgagct tagggactta atggtgtatg acggattaac       720
     gtgcgcattt gacgaggtgc acatggctgt tcacggaaat acagctgcca aggaatatgc       780
     aatctcacga agagagcagg acgaatgggc gttgagaagt catgcaaggg cagctaaggc       840
     cgccgatgaa gggaagtttc aggatgaaat tgttcccgtc aactggatcg gtcgaaaagg       900
     aaaaccaaac gttgttgata aagatgaagc gattcgccgt gacacaagtc tggatcagct       960
     cgcaaaactt gctccgattt atgcaagtga cggttctatc acagccggca atgctcctgg      1020
     agtcaatgac ggagccggcg cgttcgtgct gatgtctgag gaaaaagctg ctgagcttgg      1080
     caaacggcct ctggctacaa ttcttggttt ttcaactacg ggaatgccag cgcacgagct      1140
     ggcggcagcg ccagggtttg ctattaacaa gctcctgaaa aagaatggtt taactgtcca      1200
     agatattgac ttgtttgaag taaatgaagc ttttgcttca gttgttttga catgtgaaaa      1260
     aatcgtaggt ttcgatcttg aaaaagtaaa tgtgaatggc ggtgcgatcg cgctcggcca      1320
     cccgatcggc gcgagcggtg cgagaattct catgacgctt gtttatgaat taaagcgacg      1380
     gggagggggt ctgggcgttg ccgctatttg cagcggggca gcacagggag acgccgtctt      1440
     agtgcaggtt cattaaaaca tgatgaaaaa ggggatttga atggaaatca aacaaatcat      1500
     ggtagctggc gcaggtcaga tggggagcgg aattgctcaa acagccgccg acgcgggctt      1560
     ttatgtgcgg atgtatgatg tgaatccaga ggccgcggag gcaggattga aacggctgaa      1620
     gaaacagctg gcccgtgatg ctgagaaagg aaaaaggacc gagacggaag tgaagagcgt      1680
     aatcaaccgc atttcgattt ctcaaacact tgaggaggca gagcatgcgg acattgtgat      1740
     tgaggctatc gcagaaaaca tggcggcaaa aactgagatg tttaaaacac ttgatcgcat      1800
     ttgcccgcct catacgattt tggccagcaa tacatcttcc ttgcctatta cagaaatcgc      1860
     tgctgtaaca aaccggcctc aacgggttat tggcatgcat tttatgaatc ccgtccctgt      1920
     aatgaagctg gtagaagtga ttcgaggctt ggctacatca gaagaaacgg ccttagatgt      1980
     tatggcatta gcggaaaaga tggggaaaac agcggtagaa gtcaatgatt ttcctgggtt      2040
     tgtttccaac cgtgtgcttc ttccaatgat taatgaagcc atctattgcg tgtatgaggg      2100
     agtggcgaag ccggaggcaa tagatgaagt gatgaagctg ggcatgaatc atccgatggg      2160
     tccgcttgca ttagcggatt ttatcggact ggatacgtgt ttatcaatta tggaagtcct      2220
     tcactcaggc cttggcgatt ccaaataccg tccttgcccg ctgctccgca agtatgtcaa      2280
     agcaggctgg cttggcaaaa agagcggacg cggtttttat gactatgagg agaagacttc      2340
     ctgaagtcta ttccatccgg gggtggccga gttgcatgta acccaagagc aagtcatgat      2400
     gcgaaaaatg gtgcgtgatt ttgcacgaaa agaaattgct cccgctgcgg aaatcatgga      2460
     gaaaacggac gaatttccct ttcagctgat caaaaaaatg ggtaaacacg gactgatggg      2520
     aataccggtg ccggaacaat acggcggtgc tggagcggac gttgtttctt atattttggc      2580
     aattcatgag atttctagaa tcagcgcggc tgtcggcgtg attctctccg ttcatacctc      2640
     agtcggcacg aatccgatta tgtatttcgg caacgaagaa cagaagatga aatatatacc      2700
     aaatctcgcg tcaggagacc atttgggcgc atttgcacta acggagcctc actcggggtc      2760
     ggatgccggg agcctccgca caacagcaat caaaaagaac ggcaaatacc tattaaacgg      2820
     atcgaaaata ttcataacga atggcggagc agctgatatc tatatcacat ttgctttaac      2880
     agatccagat caaggcaggc acgggatttc ggcttttatt gttgaaaaaa acacacccgg      2940
     ttttaccgtt ggaaaaaaag aaagaaagct ggggctttat ggctccaata ctacggaact      3000
     gatttttgat aatgcagaag tgcctgaagc caatttgctt ggcaaagagg gggatggctt      3060
     tcacattgcc atggcgaatt taaatgtcgg ccggatcggc attgcggcac aggccctcgg      3120
     aattgcagag gcggctcttg agcatgccgt tgattatgcg aagcagcgag tgcaatttgg      3180
     aaggccgatt gcagccaatc aaggcatatc atttaagctg gctgatatgg cgactagagc      3240
     tgaggcggca agacatcttg tctaccacgc tgcagacctt cataaccgcg gcctaaactg      3300
     tggaaaagaa gcgtctatgg ctaaacaatt tgcttccgat gcagccgtaa aggcggcgtt      3360
     agacgccgtt caaatttatg ggggatatgg ctatatgaag gattatccag ttgagcgcct      3420
     gcttcgcgat gcaaaggtga cgcaaattta tgaagggacg aacgagattc aaagactgat      3480
     tatttccaag tatttgcttg gcggaacctg atagacaaaa aacgcaaaaa cggaggttga      3540
     ggatatggag gagaaacagc attattctcc agggttggac ggtgtgattg cggcagaaac      3600
     tcatatttct tatcttgaca cgcagtccag ccagattttg ataagaggct atgatttaat      3660
     agaactttct gaaacaaaaa gctatctgga gcttgtccat ttattgctgg agggcaggct      3720
     gccagaagaa agtgaaatgg aaacgctgga acgtaaaata aacagtgcct caagcctgcc      3780
     tgctgatcat ctccgtctgc ttgagctgct ccctgaggac actcatccaa tggatggtct      3840
     gcgtaccggc ctgtcggcac ttgctggcta tgatcggcaa attgatgatc ggtctccttc      3900
     cgcaaacaaa gaacgcgcct atcagcttct tgggaaaatg cctgccctca ctgctgccag      3960
     ctacaggatc attaataaga aagaaccgat tcttccgctt caaaccctat cctacagtgc      4020
     gaattttctc tacatgatga cagggaaatt gccgtcttca ttggaagaac agatttttga      4080
     ccggtcgctc gtcctgtaca gtgagcatga gatgccgaat tcaacctttg cggccagggt      4140
     cattgcatct acacattcag atctttatgg ggctttgact ggggctgtcg cttccctgaa      4200
     agggaatctt cacggaggag caaacgaagc tgtgatgtat ttgcttttgg aggcaaaaac      4260
     gacatctgat tttgagcagc ttttgcaaac aaaactgaaa agaaaagaaa aaatcatggg      4320
     cttcggccac cgggtgtata tgaaaaaaat ggacccgaga gcactcatga tgaaagaggc      4380
     gctgcagcaa ttatgcgata aagccggtga ccatcgttta tatgagatgt gcgaagcggg      4440
     tgagcggctg atggagaagg aaaaagggct ttacccgaat ttggattact atgctgcccc      4500
     agtgtattgg atgctcggca taccgattcc tttatatacg ccgatctttt tcagcgcgag      4560
     aacgtccggt ttatgcgccc atgtgatcga acagcatgcc aataatcggc tcttccgtcc      4620
     ccgtgtcagt tacatgggcc cgcgatatca aacaaaatca tgaaaggagc tggtagaatg      4680
     ccgaaaacgg atcgtgttat cgaagaaatc acagactatg tgcttgagaa agagattact      4740
     agtgccgaag cgtatacaac agcggggcat gtattgctgg ataccctggg ctgcggaatc      4800
     ttggcgctac ggtatccgga atgcacaaag ctgcttggcc cgattgttcc aggaacgact      4860
     gtgccgaatg gaagcaaagt gccgggaacg tcatatgttc tcgatcctgt gagggcagcg      4920
     tttaatattg gctgcatgat tcgctggctc gattacaacg atacgtggct ggcggcggag      4980
     tgggggcatc catccgataa cttgggagga atccttgccg ctgctgatta tgtatcaaga      5040
     gtgaggctgt ctgaaggaaa agagccgtta acggtacgcg acgtacttga gatgatgatc      5100
     aaagcacacg agatccaagg tgtgctggcg ttagaaaaca gcttaaatcg agttggcctt      5160
     gaccatgtgc tgtttgtcaa agttgcgaca actgctgttg cagcaaagct t               5211
//

If you have problems or comments...

PBIL Back to PBIL home page