(data stored in ACNUC16935 zone)

EMBL: U29158

ID   U29158; SV 1; linear; mRNA; STD; PLN; 1381 BP.
XX
AC   U29158;
XX
DT   19-JUL-1995 (Rel. 44, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Zea mays polyubiquitin (MubC5) mRNA, complete cds.
XX
KW   .
XX
OS   Zea mays
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade;
OC   Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea.
XX
RN   [1]
RP   1-1381
RX   PUBMED; 7662312.
RA   Liu L., Maillet D.S., Frappier J.R., Walden D.B., Atkinson B.G.;
RT   "Characterization, chromosomal mapping, and expression of different
RT   polyubiquitin genes in tissues from control and heat-shocked maize
RT   seedlings";
RL   Biochem. Cell Biol. 73(1-2):19-30(1995).
XX
RN   [2]
RP   1-1381
RA   Frappier J.R.H.;
RT   ;
RL   Submitted (14-JUN-1995) to the INSDC.
RL   J. Roger H. Frappier, Zoology, University of Western Ontario, Rm 340 B&G
RL   Bldg., London, Ontario, N6A 2T2, Canada
XX
DR   MD5; 3b56f5e5de92afb601a2d833633068ee.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1381
FT                   /organism="Zea mays"
FT                   /chromosome="4"
FT                   /map="4L position 188"
FT                   /strain="Oh43"
FT                   /mol_type="mRNA"
FT                   /dev_stage="5-day-old radicles"
FT                   /clone="cMubC5"
FT                   /tissue_type="radicle"
FT                   /db_xref="taxon:4577"
FT   mat_peptide     27..254
FT                   /gene="MubC5"
FT                   /product="ubiquitin"
FT   CDS_pept        27..1172
FT                   /codon_start=1
FT                   /gene="MubC5"
FT                   /product="polyubiquitin"
FT                   /note="contains 5 ubiquitin monomers"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q41751"
FT                   /protein_id="AAC49025.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGQ"
FT   mat_peptide     255..482
FT                   /gene="MubC5"
FT                   /product="ubiquitin"
FT   mat_peptide     483..710
FT                   /gene="MubC5"
FT                   /product="ubiquitin"
FT   mat_peptide     711..938
FT                   /gene="MubC5"
FT                   /product="ubiquitin"
FT   mat_peptide     939..1169
FT                   /gene="MubC5"
FT                   /product="ubiquitin"
FT   regulatory      1260..1265
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1381 BP; 322 A; 402 C; 373 G; 284 T; 0 other;
     ccccccgatc ccctcgtcga tccaagatgc agatcttcgt caagactctc actggaaaga        60
     ctatcaccct cgaggtggag tcctctgaca ccattgacaa cgtcaaggcc aagatccagg       120
     acaaggaagg cattcccccg gaccagcagc ggctcatctt cgctggcaag cagctcgagg       180
     acgggcgcac acttgccgac tacaacatcc agaaggagag caccctccac cttgttctcc       240
     gcctcagggg aggcatgcag atcttcgtca agaccctcac tggaaagact atcaccctcg       300
     aggtggagtc ttctgacacc atcgacaacg tcaaggccaa gatccaggac aaggagggga       360
     ttcctccgga ccagcagcgc ctgatctttg ctggcaagca gctcgaggac gggcgcacgc       420
     tggccgacta caacattcag aaggagagca ccctccactt ggtgttgcgt ctcaggggcg       480
     gcatgcagat cttcgtgaag actctgactg gcaagactat cacccttgag gtcgagtctt       540
     ctgataccat tgacaatgtc aaggccaaga tccaggacaa ggagggcatc cctccggacc       600
     agcagcggct catttttgcc ggcaagcagc tcgaggacgg gcgcacgctt gccgactaca       660
     acattcagaa ggagagcacc ctccacttgg tgctgcgtct caggggtggc atgcagatct       720
     tcgtgaagac acttactggc aagacgatca cccttgaggt ggagtcctcg gacaccatcg       780
     acaatgtcaa ggccaagatc caggacaagg agggcattcc accggaccag cagcgcctga       840
     tctttgctgg caagcagctg gaggatggcc gtaccctcgc cgactacaac atccagaagg       900
     agagcaccct ccacctggtc gtccgcttgc gaggtggtat gcagatcttt gtgaagacct       960
     tgactggcaa gaccataacc ctggaggttg agagctccga caccatcgac aacgtgaagg      1020
     cgaagatcca ggacaaagag ggcatccctc cagaccagca gcgtctgatc tttgccggca      1080
     agcagctgga ggatggccgc accctagcag actacaacat ccagaaggag agcactctcc      1140
     acctggtgct ccgcctccgc ggtggtcagt aagccatggt tcatttaagc tgctgctgta      1200
     cctgggtatc tgcgtcgtct ggtgccctct ggtgtacctc tatatggatg tcgtcgtcta      1260
     ataaacatct gtggtttgtg tgtcatgaat cgtggttgtg gcttcgttgg tttaatggac      1320
     ctgttgtgtc ctctgtgttg tacccaaaac tcttctgcag cagtatgctt gaatccttat      1380
     g                                                                      1381
//

If you have problems or comments...

PBIL Back to PBIL home page