(data stored in SCRATCH zone)

EMBL: U29177

ID   U29177; SV 1; linear; genomic DNA; STD; PRO; 3346 BP.
XX
AC   U29177;
XX
DT   19-JUL-1995 (Rel. 44, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Bacillus subtilis PhoH (phoH) gene, partial cds, diacylglycerol kinase
DE   (dgk) gene, complete cds, and cytidine deaminase (cdd) gene, partial cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-3346
RA   Kim K., Hwang S., Suh J., Song B.H., Hong S., Kim J.;
RT   "Nucleotide sequence on upstream of the cdd locus in Bacillus subtilis";
RL   J. Microbiol. Biotechnol. 5(3):0(1995).
XX
RN   [2]
RX   DOI; 10.1007/BF00334391.
RX   PUBMED; 2526291.
RA   Song B.H., Neuhard J.;
RT   "Chromosomal location, cloning and nucleotide sequence of the Bacillus
RT   subtilis cdd gene encoding cytidine/deoxycytidine deaminase";
RL   Mol. Gen. Genet. 216(2-3):462-468(1989).
XX
RN   [3]
RP   1-3346
RA   Song B.H.;
RT   ;
RL   Submitted (14-JUN-1995) to the INSDC.
RL   B. H. Song, Department of Biology, Kyungpook National University, Teachers
RL   College, 1370 Sankyuck-Dong, Buk-Gu, Taegu 702-701, Korea
XX
DR   MD5; 7c2626ee7cd3c9275c34c9dcc0e7dc23.
DR   EuropePMC; PMC98450; 10899901.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3346
FT                   /organism="Bacillus subtilis"
FT                   /strain="ED40"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   gene            1..181
FT                   /gene="phoH"
FT   CDS_pept        <1..181
FT                   /codon_start=2
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /product="PhoH"
FT                   /note="phosphate starvation inducible gene"
FT                   /db_xref="GOA:P46343"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46343"
FT                   /protein_id="AAA70039.1"
FT                   /translation="IITGDVSQIDLPKRVKSGLAVAKEMLKGIDGISMIELDQTDVVRH
FT                   PLVAKIIEAYDKQN"
FT   CDS_pept        181..528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /note="orf1"
FT                   /db_xref="GOA:P46344"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011621"
FT                   /db_xref="InterPro:IPR011624"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46344"
FT                   /protein_id="AAA70040.1"
FT                   /translation="MLNDPIARYRVIFMIAYGLDVSRGGSCVEKKAKTKSSSKKWSSFK
FT                   NARSMHVLLYLLLAAIMFALLFVHVKPETLDLDLFSVSDKTIYTPATVEDQKATEEKSK
FT                   PLRTRLKINIH"
FT   CDS_pept        639..1904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /note="orf2"
FT                   /db_xref="GOA:P46344"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011621"
FT                   /db_xref="InterPro:IPR011624"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46344"
FT                   /protein_id="AAA70041.1"
FT                   /translation="MVKSVKDKLTSDVNDSISEDSIKTLLKADSEDFSFVRDTVITAVN
FT                   TVMSSEIPSDKLSDAKDKVEKELKSNSIPSKYLGAATEIGRFAIIPNYVFDPKATEAKR
FT                   QEASDNVQQVQIKQGQVLVEENDLIDREVYRKLELTGLLNNSNLFKPIKPISGLLIMIG
FT                   LFIATLVYYFEKQKQNLKFKNQSILLFSIITTLLLVIMEVVSLFQKMEYNNIGYLVPIA
FT                   AGAILIKLLMNERIAILGSIILAICGSMMFNQGVTGTFNYVIGIYYLISGISGVLFLGK
FT                   HNARSKILQTGLFVAFINMVVVLSLLLIQNTALSGLEIGTLMLMGVVSGFASSVLIIGL
FT                   MPFFETGFGILSTMRLLELSNPNHPLLRKILTETPGTYHHSVMVANLSEAACEAVGANG
FT                   LLARVRRILSRSRKNKAPAIFY"
FT   CDS_pept        1995..2270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /note="orf3"
FT                   /db_xref="GOA:P46344"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011621"
FT                   /db_xref="InterPro:IPR011624"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46344"
FT                   /protein_id="AAA70042.1"
FT                   /translation="MLRSYKFPKELVDIAEQHHGTSLLKFFYYKAKEKGDQITEEEFVI
FT                   RDRSRSQRKPQLYQWPTVLKRPSDPCTIQILNELKSFRTDSSVNAI"
FT   CDS_pept        2375..2650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /note="orf4"
FT                   /db_xref="GOA:P46347"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46347"
FT                   /protein_id="AAA70043.1"
FT                   /translation="MSLLIDIVDETGSVSEEMLKEVENLLQFAAELKAFRIRLKFLSRL
FT                   FPMMTYIRLTKNTGERMLRQMSSHLLLKKREKARSKSWAPKCSGFR"
FT   gene            2793..3197
FT                   /gene="dgk"
FT   CDS_pept        2793..3197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="GOA:P19638"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19638"
FT                   /protein_id="AAA70044.1"
FT                   /translation="MFTKQKEFWTLMDSKDHRNELNRFFKSFVHAGRGIWETARTERNF
FT                   QFHAAAACAVLICGFLVELSIIEWMIIFLLIGGMFSLELLNTAIEHTVDLITDKHHPLA
FT                   KAAKDAAAGAVCVFAVISSIIGLLIFLPKL"
FT   gene            3316..3346
FT                   /gene="cdd"
FT   CDS_pept        3316..>3346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdd"
FT                   /product="cytidine deaminase"
FT                   /db_xref="GOA:P19079"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="PDB:1JTK"
FT                   /db_xref="PDB:1UWZ"
FT                   /db_xref="PDB:1UX0"
FT                   /db_xref="PDB:1UX1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19079"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAA70045.1"
FT                   /translation="MNRQELITEA"
XX
SQ   Sequence 3346 BP; 1032 A; 627 C; 780 G; 907 T; 0 other;
     gatcattaca ggtgacgtta gccaaattga tctgccgaaa cgggtcaaat cgggacttgc        60
     agtagcgaag gagatgctga aaggaataga cggcatttct atgattgagc tagaccagac       120
     agacgtggtc agacatccgc ttgttgcgaa aattattgaa gcatacgata agcaaaatta       180
     atgctgaatg acccgatcgc gcgttatcgg gtcattttta tgattgctta tgggcttgat       240
     gtttcaagag gaggttcttg tgttgaaaag aaggctaaga ccaaaagcag ctcaaaaaaa       300
     tggagcagtt ttaaaaatgc ccgctccatg catgtactgc tgtatcttct gctggctgcc       360
     attatgtttg ctttgctctt tgtacatgtt aagccggaaa cacttgattt agacctgttt       420
     tcagtcagcg acaagaccat ttacactccg gcaaccgtag aagatcaaaa agccacagag       480
     gaaaaaagca agccgctcag gacgcggttg aagatcaata tacattaaaa aaagaatata       540
     cagacaatcg gattgacctt gtgtcatcaa tattcgacag tattagtgaa gtgaaaaaat       600
     catcggaaga aggcagtaaa tcaccatcgg aaaaatcaat ggtcaaatct gtaaaggaca       660
     aattgacatc agatgtgaat gattctatat cggaggattc catcaagaca ttgctgaaag       720
     cagacagtga agacttttct tttgtcagag atacggtcat taccgcggta aatacggtca       780
     tgagcagtga aatcccttcg gataaactat ctgatgcaaa ggataaggta gaaaaagagc       840
     taaagagcaa ttctattccg tctaaatact tgggagccgc gacagaaatc gggcgttttg       900
     ctattattcc gaattacgtc ttcgatccga aagcaacaga ggcaaaacgg caggaagcct       960
     cagataatgt ccagcaggtt caaatcaaac aggggcaagt gctcgtggaa gaaaatgacc      1020
     tcattgatcg ggaagtgtac aggaaacttg agctgaccgg gttattaaat aactcaaatc      1080
     tctttaaacc gatcaaaccg atcagcgggc tattgattat gatcggactt ttcattgcaa      1140
     cacttgtata ttattttgaa aaacagaaac aaaatctgaa gtttaaaaac caatccattc      1200
     tgttattctc cataatcaca acacttttgc ttgtgatcat ggaggttgtc agtttgtttc      1260
     agaagatgga gtataataat atcggctatc tggtccccat tgcggccggc gccatcttaa      1320
     tcaaactgct gatgaatgaa cgcattgcca ttttgggaag tatcattctt gcgatttgcg      1380
     gaagtatgat gtttaatcag ggtgtgacag gaacattcaa ttatgtcata gggatttatt      1440
     atttgatcag cggcatttca ggtgtattat ttttaggaaa acacaatgca agatcaaaga      1500
     ttttgcagac cggacttttc gtggcgttta ttaatatggt tgtcgttcta tccttattat      1560
     tgatccagaa cactgcgctg tcgggtcttg aaatcggcac gttaatgctc atgggggttg      1620
     tgtcggggtt tgcttcatct gtattgatca tcggtctgat gccgtttttt gagacgggct      1680
     ttggcatttt atccaccatg aggctgctcg agctgtctaa tcctaaccat ccgctattgc      1740
     gcaaaatact gacggaaaca ccaggtacat atcatcacag tgtaatggtt gccaatttat      1800
     cagaggcagc ctgtgaagcg gttggggcta atggtttgct tgcaagagtc aggcgcatat      1860
     tatcacgatc tcggaaaaac aaagcgcccg caatatttta ttgaaaacca aatgaatatt      1920
     gacaatccgc atgacaagct gcacctcagt tgagcaaaaa tattattatc tcgcatacga      1980
     cagacggtgc gaatatgctg agaagctata aatttccgaa agagcttgtc gatattgctg      2040
     agcagcatca tggaacctcg cttttaaagt ttttttacta taaagcgaag gaaaaaggcg      2100
     accagattac agaggaagag ttcgttatcc gggaccgaag ccgcagtcaa aggaagccgc      2160
     aattatatca gtggccgaca gtgttgaagc ggccgtcaga tccatgcaca atccaaatcc      2220
     tgaacgaatt gaaaagcttc aggacggaca gttcagtgaa tgcgatttga catttaaaga      2280
     gctggataca atcgcaaaaa cgctctgtgc aacattaaaa ggaattttcc actcccggat      2340
     tgaatatccg gaggctacta agaaggtgaa atagatgagt ttactgattg atatcgttga      2400
     tgaaacggga agcgtctcag aagagatgct caaagaagta gaaaatctgc ttcaatttgc      2460
     cgctgagctg aaggcgttca ggatcaggct gaagtttctg tcacgattgt ttccaatgat      2520
     gacatacatc agattaacaa agaataccgg ggaaaggatg ctccgacaga tgtcatctca      2580
     tttgctcttg aagaagaggg agaaggcgag atcgaaatcg tgggcgccga aatgctccgg      2640
     ttttaggtga tattatcatc agtgccgatc gcacaagaga gcaggcagag gagtataatc      2700
     attcttttaa aagagagctc ggatttctag ctgtacacgg atttctgcac cttttaggat      2760
     atgaccatat gacgaaagag gaagaagagg agatgtttac taagcaaaag gaattctgga      2820
     cgcttatgga ctcaaaagat catagaaatg agctgaatcg attcttcaaa agcttcgtgc      2880
     atgcaggccg gggcatatgg gaaacagcgc ggacggagcg gaatttccaa tttcatgccg      2940
     cagccgcctg cgctgttctc atttgcggct tccttgtaga gctcagcatt attgagtgga      3000
     tgattatatt ccttttgata ggtggtatgt tttcgcttga acttttaaat acagccattg      3060
     aacatacggt tgatttaata actgacaaac atcaccctct tgctaaagcg gccaaggacg      3120
     ctgccgccgg ggctgtttgc gtttttgccg tgatttcgtc tatcattggt ttacttattt      3180
     ttttgccaaa gctgtaatgg ctgaaaattc ttacatttat tttacatttt tagaaatggg      3240
     cgtgaaaaaa agcgcgcgat tatgtaaaat ataaagtgat agcggtacca ttataggtaa      3300
     gagaggaatg tacacatgaa cagacaagaa ttaataacag aagctt                     3346
//

If you have problems or comments...

PBIL Back to PBIL home page