(data stored in SCRATCH zone)

EMBL: U32685

ID   U32685; SV 1; linear; genomic DNA; STD; PRO; 2675 BP.
XX
AC   U32685;
XX
DT   17-AUG-1995 (Rel. 44, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Bacillus subtilis RipX (ripX) gene, partial cds, purine nucleoside
DE   phosphorylase (pnp) and phosphopentomutase (drm) genes, complete cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-2675
RX   PUBMED; 10537218.
RA   Schuch R., Garibian A., Saxild H.H., Piggot P.J., Nygaard P.;
RT   "Nucleosides as a carbon source in Bacillus subtilis: characterization of
RT   the drm-pupG operon";
RL   Microbiology (Reading, Engl.) 145(10):2957-2966(1999).
XX
RN   [2]
RP   1-2675
RA   Schuch R., Piggot P.J., Garibian A., Nygaard P.;
RT   ;
RL   Submitted (31-JUL-1995) to the INSDC.
RL   Raymond Schuch, Department of Microbiology, Uniformed Services University
RL   of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814-4799,
RL   USA
XX
DR   MD5; 9a171f8e9e37dce8408cd98173356597.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2675
FT                   /organism="Bacillus subtilis"
FT                   /map="211"
FT                   /strain="BR151"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..494
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /gene="ripX"
FT                   /product="RipX"
FT                   /note="similar to  site-specific recombinases/integrases
FT                   encoded by Swiss-Prot Accession Number P21891 and GenBank
FT                   Accession Numbers U32716 and U32750"
FT                   /db_xref="GOA:P46352"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46352"
FT                   /protein_id="AAA74432.1"
FT                   /translation="RDKAMLELLYATGIRVSEMIELKTADVHLSMGFIRCFGKGRKERI
FT                   VPIGEAAASAIEEYMTKARGKLLKNNVSDALFLNHHGNRSAARILEEPEKNRIGSRHKK
FT                   ELTPHTLRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYKQFHPRA
FT                   "
FT   repeat_region   494..511
FT                   /rpt_type=INVERTED
FT   regulatory      639..646
FT                   /gene="drm"
FT                   /note="putative"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        655..1845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="drm"
FT                   /standard_name="deoxyribomutase"
FT                   /product="phosphopentomutase"
FT                   /function="conversion of
FT                   ribose-1-phosphate/deoxyribose-1-phosphate to
FT                   ribose-5-phosphate/deoxyribose-5-phosphate"
FT                   /note="involved in purine nucleoside salvage"
FT                   /db_xref="GOA:P46353"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46353"
FT                   /protein_id="AAA74433.1"
FT                   /translation="MPAYKYNRVFLIVMDSVGIGEAPDAADFNDEGAHTLGHIAEHMNG
FT                   LHMPNMAKLGLGLIEDIKGVEKTEHPLAYYGKMQEASNGKDTMTGHWEIMGLYIDKPFK
FT                   VFPEGFPDELLQELEKRSGRKIIGNKPASGTAILDELGQEHMETGALIVYTSADSVLQI
FT                   AAHEEVVPLEELYRICETARELTLDPKYMVGRIIARPFVGEPGQFKFKRTPNRHDYALK
FT                   PFDRTVMNELKDCGLDVISIGKISDIYDGEGITSSRRTVSNMDGMDKVIDTLGEDFTGL
FT                   SFANLVDFDALFGHRRDPEGYGRALEEFDARLPEVFEKMREDDLLIITADHGNDPIHHG
FT                   TDHTREYVPILAYSKKHKKAQMLPLADTFADIGATIADNFQTNKPKYGKSFLSLLQ"
FT   regulatory      1844..1850
FT                   /gene="pnp"
FT                   /note="putative"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1858..2673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /product="purine nucleoside phosphorylase"
FT                   /function="cleavage of guanosine or inosine to respective
FT                   bases and sugar-1-phosphate molecules"
FT                   /note="involved in purine nucleoside salvage"
FT                   /db_xref="GOA:P46354"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46354"
FT                   /protein_id="AAA74434.1"
FT                   /translation="MKDRIERAAAFIKQNLPESPKIGLILGSGLGILADEIENPVKLKY
FT                   EDIPEFPVSTVEGHAGQLVLGTLEGVSVIAMQGRFHFYEGYSMEKVTFPVRVMKALGVE
FT                   ALIVTNAAGGVNTEFRAGDLMIITDHINFMGTNPLIGPNEADFGARFPDMSSAYDKDLS
FT                   SLAEKIAKDLNIPIQKGVYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAG
FT                   MRVLGISCISNAAAGILDQPLSHDEVMEVTEKVKAGFLKLVKAIVAQYE"
XX
SQ   Sequence 2675 BP; 775 A; 553 C; 674 G; 673 T; 0 other;
     atcgggataa agcaatgctg gagctgcttt atgcgacagg catacgagtc agtgaaatga        60
     ttgaattgaa aacggctgat gttcatttat ctatggggtt tatccgatgc ttcggcaaag       120
     gaagaaaaga acggattgtg ccaatcggtg aagccgctgc ttccgccatt gaggaatata       180
     tgacaaaagc caggggaaaa ctgttaaaaa ataatgtatc tgacgccctc tttttaaatc       240
     atcacggcaa cagatcagcc gccaggattt tggaagaacc tgaaaaaaat cgcattggaa       300
     gccggcataa gaaagagctg actccgcata cactcaggca ttcctttgcg acgcatctgc       360
     ttgagaacgg ggcagattta agagcggtgc aggaaatgct cggtcatgcg gatatatcca       420
     cgacgcaaat ttatacgcat gtgacgaaaa caaggctgaa ggatgtgtac aagcagtttc       480
     atccgcgagc atagccgcag gtggctgcgg cttttttgtt tagagcgaca gaaaatattg       540
     aagtttctca ttatttccaa atacattgtc aacgggaatg aaaacggttt atacttgagt       600
     tgtcagacct cttagcgata caatagacgt atagaaaaaa aggaggcttt caagatgcct       660
     gcatacaaat ataatcgtgt gtttttaatt gtgatggact cagtcggaat cggcgaagcg       720
     ccggatgccg ctgactttaa tgacgaaggc gctcatacgc tcggtcatat tgccgagcat       780
     atgaacggat tacatatgcc gaatatggca aagctcggcc ttggtcttat cgaagatatc       840
     aaaggtgtag aaaaaacaga acatccgctt gcctattatg gaaaaatgca agaagcgtca       900
     aacggcaaag atacgatgac cggccattgg gagattatgg gtttatacat tgataaaccg       960
     tttaaagtgt tcccggaagg ctttcctgat gaattgcttc aagagctgga aaagagatct      1020
     ggccgcaaaa ttattggaaa caagccggct tccggcacag cgattttgga tgagcttggc      1080
     caggagcaca tggagacagg ggctttaatt gtttacacgt ctgctgactc tgttctgcaa      1140
     attgccgctc acgaagaggt tgtgccgctt gaggagctgt atcgcatttg cgaaacggcg      1200
     agagagctga cgcttgatcc gaaatatatg gttggccgca ttattgcacg gccgttcgtc      1260
     ggagagccgg gtcaattcaa attcaaacgg acgccaaacc gccatgatta tgcgctgaag      1320
     ccgtttgacc gcactgtcat gaatgaattg aaagactgcg gcttagatgt gatttcaatc      1380
     ggtaaaatct ctgatattta cgacggagaa ggcattactt cttcacgcag aacggtttct      1440
     aatatggacg gaatggacaa ggtgatcgat acgctgggag aagattttac gggtctgagc      1500
     tttgcgaacc ttgttgattt tgacgcgtta ttcggacacc gccgtgaccc tgaaggctac      1560
     ggacgcgcgc ttgaagaatt tgatgcgcgg cttccggaag tgtttgaaaa aatgagagaa      1620
     gacgatctgt taattattac agccgaccac ggcaatgatc cgattcatca tgggactgac      1680
     catacacgcg agtatgtgcc gattctcgct tacagcaaaa aacataagaa agcgcaaatg      1740
     ctgccgcttg cagatacatt tgccgatatt ggcgcaacga tcgctgataa tttccaaaca      1800
     aataaaccga aatacgggaa aagcttttta tctttattac aataggggga ctgtttcttg      1860
     aaggacagaa ttgaacgcgc agccgctttt attaaacaaa acctgccgga atctccaaag      1920
     atcggcctta ttttaggctc aggtcttggc attttggcgg acgaaatcga aaatccggtc      1980
     aagctgaaat atgaagatat acctgaattc ccggtatcta ctgttgaagg gcatgccgga      2040
     cagcttgtgc ttggcactct tgaaggagtt tccgtcattg caatgcaggg ccgctttcat      2100
     ttttatgaag gctactcaat ggagaaagtc acattccctg tacgcgtgat gaaagcgctc      2160
     ggtgtggaag cgttgatcgt gacaaatgcc gcaggcggtg tcaacactga attccgtgcg      2220
     ggagatttaa tgattattac cgatcatatc aactttatgg gaacaaaccc gttaatcggg      2280
     ccaaacgaag cagatttcgg cgccagattt ccagatatgt cttcagccta tgacaaagat      2340
     ctgtccagcc tggctgaaaa gattgcgaaa gaccttaata tcccaattca aaaaggcgtg      2400
     tacactgctg tgacaggacc ttcttacgaa acaccggcag aagtccgttt cttaagaacg      2460
     atgggctctg atgcagtcgg catgtctact gttccggaag tcattgtagc gaatcatgcg      2520
     ggaatgcggg ttcttggcat ttcctgcatc tctaacgcgg cagccggaat tctggatcag      2580
     cctttaagtc acgatgaagt tatggaagtg accgaaaaag taaaagctgg attcttaaag      2640
     cttgttaaag cgatcgtcgc tcagtacgaa taaat                                 2675
//

If you have problems or comments...

PBIL Back to PBIL home page