(data stored in ACNUC7421 zone)

EMBL: U34346

ID   U34346; SV 1; linear; genomic DNA; STD; PRO; 9470 BP.
XX
AC   U34346;
XX
DT   27-OCT-1995 (Rel. 45, Created)
DT   31-AUG-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Paracoccus denitrificans NAD-GSH-dependent formaldehyde dehydrogenase
DE   (flhA), ClpP (clpP), S-formylglutathione hydrolase (fghA), PQQ-dependent
DE   dehydrogenase large subunit (xoxF), cytochrome c553i (cycB), XoxJ (xoxJ),
DE   and XoxI (xoxI) genes, complete cds.
XX
KW   .
XX
OS   Paracoccus denitrificans
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Paracoccus.
XX
RN   [1]
RP   5659-7354
RX   PUBMED; 1657873.
RA   Ras J., Reijnders W.N.M., Van Spanning R.J.M., Harms N., Oltmann L.F.,
RA   Stouthamer A.H.;
RT   "Isolation, sequencing, and mutagenesis of the gene encoding cytochrome
RT   c553i of Paracoccus denitrificans and characterization of the mutant
RT   strain";
RL   J. Bacteriol. 173(21):6971-6979(1991).
XX
RN   [2]
RP   980-2317
RX   PUBMED; 7798140.
RA   Ras J., Van Ophem P.W., Reijnders W.N., Van Spanning R.J., Duine J.A.,
RA   Stouthamer A.H., Harms N.;
RT   "Isolation, sequencing, and mutagenesis of the gene encoding NAD- and
RT   glutathione-dependent formaldehyde dehydrogenase (GD-FALDH) from Paracoccus
RT   denitrificans, in which GD-FALDH is essential for methylotrophic growth";
RL   J. Bacteriol. 177(1):247-251(1995).
XX
RN   [3]
RP   1-9470
RX   PUBMED; 8892832.
RA   Harms N., Ras J., Reijnders W.N.M., van Spanning R.J.M., Stouthamer A.H.;
RT   "S-formylglutathione hydrolase of Paracoccus denitrificans is homologous to
RT   human esterase D: a universal pathway for formaldehyde detoxification?";
RL   J. Bacteriol. 178(21):6296-6299(1996).
XX
RN   [4]
RP   1-9470
RA   Ras J.;
RT   ;
RL   Thesis (1995), Unknown Institution
XX
RN   [5]
RP   1-9470
RA   Harms N., Ras J., Koning S., Reijnders W.N., Stouthamer A.H.,
RA   van Spanning R.J.;
RT   "Genetics of C1 metabolism regulation of Paracoccus denitrificans";
RL   Unpublished.
XX
RN   [6]
RP   1-9470
RA   Harms N.;
RT   ;
RL   Submitted (21-AUG-1995) to the INSDC.
RL   Nellie Harms, Microbial Physiology, Vrije Universiteit, de Boelelaan 1087,
RL   1087 HV Amsterdam, The Netherlands
XX
DR   MD5; 14411ce3131f6d933df4303177ac2fe6.
DR   EuropePMC; PMC2395034; 18390659.
DR   EuropePMC; PMC374398; 15028703.
DR   EuropePMC; PMC94868; 11114919.
DR   EuropePMC; PMC98939; 9841665.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9470
FT                   /organism="Paracoccus denitrificans"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:266"
FT   CDS_pept        <1..350
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /note="orf1"
FT                   /db_xref="GOA:Q51668"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q51668"
FT                   /protein_id="AAC44549.1"
FT                   /translation="YLWFSMGWLTLTLGVIGVFVPVLPTVPFLLLAVWAFMRSSPRLGA
FT                   RIMRHPQFGPPIRAWRKRGVIGRGAKIWAVAGMSAGVAWAVWLGLDPRFIAAQALACTA
FT                   IAAWLVTRPEI"
FT   CDS_pept        441..1025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /note="orf 2"
FT                   /db_xref="GOA:Q51669"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR014185"
FT                   /db_xref="PDB:1X6M"
FT                   /db_xref="PDB:1XA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51669"
FT                   /protein_id="AAC44550.1"
FT                   /translation="MVDTSGVKIHPAVDNGIKPAQPGFAGGTLHCKCSTNPVRVAVRAQ
FT                   TAHNHVCGCTKCWKPEGAIFSQVAVVGRDALEVLEGAEKLEIVNAEAPIQRHRCRDCGV
FT                   HMYGRIENRDHPFYGLDFVHTELSDEDGWSAPEFAAFVSSIIESGVDPSRMEAIRARLR
FT                   ELGLEPYDALSPPLMDAIATHIAKRSGALAA"
FT   CDS_pept        1129..2256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /product="NAD-GSH-dependent formaldehyde dehydrogenase"
FT                   /function="oxidation of S-hydroxy methyl glutathione to
FT                   S-formylglutathione"
FT                   /note="GD-FALDH"
FT                   /db_xref="GOA:P45382"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45382"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC44551.1"
FT                   /translation="MRTRAAVALEAGKPLEVMEVNLEGPKAGEVMVEIKATGICHTDEF
FT                   TLSGADPEGLFPSILGHEGAGVVVEVGPGVTSVKPGNHVIPLYTPECRQCASCLSGKTN
FT                   LCTAIRATQGQGLMPDGTSRFSMLDGTPIFHYMGCSTFSNYTVLPEIAVAKVREDAPFD
FT                   KICYIGCGVTTGIGAVINTAKVEIGAKAVVFGLGGIGLNVLQGLRLAGADMIIGVDLND
FT                   DKKPMAEHFGMTHFINPKNCENVVQEIVNLTKTPFDQIGGADYSFDCTGNVKVMRDALE
FT                   CTHRGWGQSIIIGVAPAGAEISTRPFQLVTGRVWKGTAFGGARGRTDVPQIVDWYMDGK
FT                   IEIDPMITHTLSLDDINKGFDLMHAGESIRSVVLY"
FT   CDS_pept        2332..2967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /product="ClpP"
FT                   /db_xref="GOA:P54414"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54414"
FT                   /protein_id="AAC44552.1"
FT                   /translation="MAKISTWTTMTTMTTSAARKGLRTRGSACPRATRSASSISSRAQV
FT                   IVAGPITDKLAQRTVAHLLALAEDSDEPINMLISSPGGHVESGDMIHDVIKFIRPTVRT
FT                   IGLAWVASAGALIFVGADKENRYCLPNTRFLIHQPSVGIGGTSTDMMIQAEQVRLMRDR
FT                   LNQIFAEATGQPVERIEKDTQRDFWLNTQEALDYGLLGKVIRSVDELK"
FT   CDS_pept        2964..3485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /note="orf 3"
FT                   /db_xref="GOA:Q51670"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q51670"
FT                   /protein_id="AAC44553.1"
FT                   /translation="MSAGGTGILIRPATPDDHQAIWAILEPVYRAGETYCIPPDISRDE
FT                   ALADWFAAPFTVFVAELDGRVLGTSHVGRNRPGPASHVANASFATHPDARGHGIARELV
FT                   GHAKDWARAQGFRAMQFNFVVSTNADAVHSWQKAGFDIVGRLPAAFLHPRHGYVDALVM
FT                   FHDLTEGKNP"
FT   CDS_pept        3482..4321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fghA"
FT                   /product="S-formylglutathione hydrolase"
FT                   /function="hydrolyzation of S-formylglutathione to formate
FT                   and reduced glutathione"
FT                   /note="similar to human esterase D; FGH"
FT                   /db_xref="GOA:A1AXZ2"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AXZ2"
FT                   /protein_id="AAC44554.1"
FT                   /translation="MTLAYETVSENRSFGGIQGVYRHQSQATGTPMTFAIYLPPDARHG
FT                   KVPVLWYLSGLTCTHENAMTKAGAQEWAAEYGIAVIFPDTSPRGEGVANDETYDLGQGA
FT                   GFYVDATEAPWAPHFRMWHYVTHELPELVFNNFPLDREAQGITGHSMGGHGALTIAMTF
FT                   PERYRSVSAFAPIAHPSESDWGRKQFAAYLGDDKAAWKRHDSTILMREKGYPGEVLIDQ
FT                   GASDQFLDLLKPEALAHAMAERRQPGTFRMQQGYDHSYFFVQSFMADHIPLARGALG"
FT   CDS_pept        4523..6325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xoxF"
FT                   /product="PQQ-dependent dehydrogenase large subunit"
FT                   /function="unknown"
FT                   /db_xref="GOA:P29968"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/Swiss-Prot:P29968"
FT                   /protein_id="AAC44555.1"
FT                   /translation="MKNLMNGACLALLMSGTAALANEQRAGRDRQAPQWAIQMGDYANT
FT                   RYSTLDQINKDNVKDLRVAWTFSTGVLRGHEGSPLVIGDVMYVHTPFPNRVFALDLNDN
FT                   GKILWRYEPQQDPNVIAVMSCDTVYRGLSYADGMILLGQADTTVVALDATSGEVKWSTK
FT                   IGDPGIGETLTATVVPVKDKVLVGISGGEYGVRGRMTALNLTDGSEAWKAWSTGPDEEL
FT                   LVDPETTTHLGKPIGADSSLNSWEGDQWQIGGGTIWGWFSYDPDLNLVYYGTGNPSTWN
FT                   PSQRPGDNKWSMTIMARDADTGMAKWFYQMTPHDEWDYDGVNEMILTNQTVDGQERKLL
FT                   THFDRNGLAYTMDRETGELLVAEKYDPVVNWTTGVDMDPNSETYGRPAVVAEYSTAQNG
FT                   EDENTTGVCPAALGTKDQQPAAFSPKTNLFYVPTNHVCMDYEPFRVAYTAGQPYVGATL
FT                   SMYPAPNSHGGMGNFIAWHNTTGEIKWSVPEQFSVWSGALATAGDVVFYGTLEGYLKPV
FT                   DAQTGEELYKFKTPSGIIGNVMTYEHGGKQYVGILSGVGGWAGIGLAAGLTNPNDGLGA
FT                   VGGYASLSQYTELGGQLTVFELPG"
FT   CDS_pept        6427..7107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycB"
FT                   /product="cytochrome c553i"
FT                   /db_xref="GOA:Q51672"
FT                   /db_xref="InterPro:IPR022411"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q51672"
FT                   /protein_id="AAC44556.1"
FT                   /translation="MTSKTTASLLAICVACAASAIAGTALCADRRNAPAQAGAGAAAAV
FT                   SGDAHEQPAAEAPAEEEEETPAVAATDGKLVLPNGQDITPDHMENGRWYTAEDIPTYKI
FT                   AEDGAVDWATFSGYRRYSAECHVCHGPDGEGSTYAPALRKSVLTMGYYDFLEIAASGKQ
FT                   EVNTAANLVMPAFGTNKNVWCYIDDIYAYLLARGTGDLPRGRPAKREDKSDEFVAQEDS
FT                   CMSG"
FT   CDS_pept        7104..7907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xoxJ"
FT                   /product="XoxJ"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR022448"
FT                   /db_xref="UniProtKB/TrEMBL:Q51673"
FT                   /protein_id="AAC44557.1"
FT                   /translation="MRRALTLAVLATCAVLPALAQVADLRSKTEFRVCADPAAVPMSSQ
FT                   DGKGFENRIAQLFAEKLGVPVAYTWFPQGPGFIRKTLRAGLCDVVIGYAQGDEMVQNTN
FT                   HYYTSAYGIVTRNDSPLASVEALDDPALGGHPIGVVAGTPPASNLARAGLAKNMRGWDL
FT                   FVDRRVEDPVGDMLAQVKSGELAAAVIWGPLAGPLVKQDPELQFTPLLKESGGPRMFYR
FT                   ITMGVRLGEQEWKRELNSLIRRHQDEIDAILRDAGVPLLDDYGRL"
FT   CDS_pept        8035..8586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xoxI"
FT                   /product="XoxI"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q51674"
FT                   /protein_id="AAC44558.1"
FT                   /translation="MIRLLALTMGAALALAPAAEAHGPPRLKLEMQQKLDATPDEVWTA
FT                   IGRFDDMSWHPAIASLELTGDGSADQPETSTRVLHLKSDAGDPTITEVLSKWQPEKHCY
FT                   AYRIEAVEVTVLPVTNYAATLCVKDEGGKAVVNWKGGFYRGYPNNEPPPELSDEAAIKA
FT                   VTGVYQAGLDALAERFGKAE"
FT   CDS_pept        complement(8770..9348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /note="orf4"
FT                   /db_xref="InterPro:IPR021698"
FT                   /db_xref="UniProtKB/TrEMBL:Q51675"
FT                   /protein_id="AAC44559.1"
FT                   /translation="MAETVIAEDLRSRGFTLLDPPADQVARIKNPTQSNGSDSRIARDM
FT                   GAHYAISGEVQKVSNLILSLNLYIRDAESGDTVRAGVVDIRGNTDESFHGEPYRSETPA
FT                   TLAGAQVIDAAEAMRLHAQGVPFIDVLPRTARPEGLPEARFGTNRRIFPFPARPGFTIP
FT                   DMTGWPRRNRRGWPRGWHGCRGATGLRPW"
XX
SQ   Sequence 9470 BP; 1740 A; 3046 C; 3113 G; 1571 T; 0 other;
     gatatctctg gttctccatg ggctggctga ccttgacgct gggcgtgatc ggggtcttcg        60
     tgccggtcct gccgaccgtg ccgttcctgc tgcttgcggt ctgggccttc atgcgctcgt       120
     ctccccggct gggcgcacgc atcatgcgcc acccgcaatt cggcccgccg atccgcgcct       180
     ggcgcaagcg cggcgtcatc ggccgcgggg ccaagatctg ggccgtcgcc ggcatgtcgg       240
     ccggcgtcgc atgggcggtc tggctgggcc ttgatccgcg cttcatcgct gcgcaggcat       300
     tggcctgcac cgccatcgcc gcctggctgg tgacccgccc cgagatctga gccggcaggg       360
     attacaacct tttgcccact tgttccggcc ctgccatggc gcgaacctcg gcgcataggt       420
     ctgaggggag gaacgggacc atggtggata catcgggggt gaagatccac cccgcagtcg       480
     acaacggcat caagccggcc cagcccgggt tcgcgggcgg cacgctgcat tgcaagtgca       540
     gcaccaaccc ggtccgggtc gcggtccggg cgcagaccgc ccacaaccat gtctgcggct       600
     gcacgaaatg ctggaagccc gagggcgcga tcttttcgca ggtggcggtg gtgggccgcg       660
     atgcgctcga agtgctggaa ggcgccgaaa agctcgaaat cgtcaatgcc gaggccccga       720
     tccagcgcca tcgctgccgg gattgcggcg tgcacatgta tggccggatc gagaacaggg       780
     accatccctt ctacgggctg gatttcgtcc ataccgagct ttccgacgag gacggctggt       840
     cggcgccgga atttgcggcc ttcgtcagct cgatcatcga atcgggggtc gatcccagcc       900
     gcatggaggc gatccgcgcc agattgcgcg aactggggct ggagccctat gatgcgcttt       960
     cgccgccgct gatggatgcg atcgccaccc atatcgcgaa acggtccggc gctcttgcgg      1020
     cctgagcgcc tgacaggtca cgacgataaa cggcgggggt cggtttaccg gcccccgagg      1080
     ccatgagaag cacaacaggc ccagggccga catgaaggag aagacaagat gagaacccgt      1140
     gccgccgtgg cccttgaggc tggcaaaccg ctggaagtga tggaggtcaa cctggaaggc      1200
     ccgaaggccg gcgaggtgat ggtcgagatc aaggccaccg gcatctgcca caccgacgaa      1260
     ttcaccctgt cgggcgccga tcccgagggg ctcttcccct cgatcctggg ccatgagggc      1320
     gcgggcgtcg tggtcgaggt cggcccgggc gttacctcgg tcaagccggg caatcatgtc      1380
     atcccgctct acacgcccga gtgccggcaa tgcgcgtcct gcctgtcggg caagaccaac      1440
     ctttgcaccg ccattcgcgc cacccagggt cagggcctga tgccggacgg aaccagccgg      1500
     ttcagcatgc tcgacggcac gccgatcttt cattacatgg gctgctcgac cttctcgaac      1560
     tacaccgtgc tgccggaaat cgcggtggcc aaggtgcgcg aggacgcgcc cttcgacaag      1620
     atctgctata tcggctgcgg cgtcactacc ggcatcggcg cggtgatcaa caccgccaag      1680
     gtggaaatcg gcgccaaggc ggtggtcttc ggcctgggcg gcattgggct gaacgtgctg      1740
     caggggctgc gcctggccgg cgcggacatg atcatcggcg tcgatctgaa cgacgacaag      1800
     aagccgatgg ccgagcattt cggcatgacg catttcatca acccgaagaa ttgcgagaac      1860
     gtggtgcagg agatcgtgaa cctgaccaag acgcccttcg accagatcgg cggcgcggat      1920
     tacagcttcg actgcaccgg caacgtcaag gtgatgcgcg acgcgctgga atgcacccat      1980
     cgcggctggg gccagtcgat catcatcggc gtggcgccgg cgggggccga gatcagcacc      2040
     cgcccgttcc agctggtcac cggccgggtc tggaagggca cggccttcgg cggtgcccgc      2100
     ggccgcaccg acgtgccgca gatcgtcgac tggtatatgg acggcaagat cgagatcgac      2160
     ccgatgatca cccacaccct gtcgctggac gacatcaaca agggcttcga cctgatgcat      2220
     gcgggcgaat ccatccgctc ggtcgtcctt tactgatcgt caagggctgc ttagttaaaa      2280
     ggccggcggg ggcgggcgac cggccccgcc gtcaacatga aaggaccgat catggcaaag      2340
     atttccacct ggacgacgat gacgacgatg acgacgagcg ccgccaggaa gggtctaagg      2400
     acgaggggct cggcctgccc gagggcgaca agatcggcaa gctctatttc aagtcgcgca      2460
     caggtgatcg ttgccgggcc gatcaccgac aagctggcgc agcgcaccgt ggcgcatctg      2520
     ctggccctgg ccgaggacag cgacgagccg atcaacatgc tgatctcgtc gcccggcggc      2580
     catgtcgaat ccggcgacat gatccatgac gtgataaagt tcatccgccc gaccgtgcgc      2640
     accatcggct tggcctgggt cgcctcggcc ggcgcgctga tctttgtcgg cgcggacaag      2700
     gaaaaccgct attgcctgcc caacacccgc ttcctgatcc accagccctc ggtcgggatc      2760
     ggcggcacgt ccacggacat gatgatccag gccgagcagg tgcggctgat gcgcgaccgg      2820
     ctgaaccaga tctttgccga ggccaccggc cagccggtcg agcggatcga aaaggacacc      2880
     cagcgcgact tctggctgaa cacgcaagag gcgctggact acggcctcct gggcaaggtc      2940
     atccgctcgg tggacgagct gaaatgagcg cgggcgggac aggcatcctg atccgtcccg      3000
     ccacgcccga cgaccatcag gcgatctggg cgatcctgga gcccgtctat cgggcgggcg      3060
     agacctattg catcccgccc gacatctcgc gggacgaggc gctggccgac tggttcgccg      3120
     cgcctttcac ggttttcgtg gccgagctgg acgggcgagt gctgggcacc agccatgtcg      3180
     gccgcaaccg gcccggcccc gcaagccatg tcgccaatgc cagctttgcc acccacccgg      3240
     atgcgcgtgg ccatggtatc gcccgcgaac tggtcggcca tgccaaggat tgggcgcggg      3300
     cgcagggttt ccgggcgatg cagttcaact tcgtcgtctc gaccaatgcc gatgccgttc      3360
     attcgtggca gaaagccggt ttcgatattg tcgggcgcct gccggctgca tttcttcatc      3420
     cccggcatgg ctatgtggat gcgctggtca tgttccacga cttgacagaa gggaagaacc      3480
     catgacgctg gcctatgaaa ccgtatcgga aaaccgcagc ttcggcggta tccagggcgt      3540
     ctatcgccac cagtcccagg cgaccggcac gccgatgacc tttgccatct acctgccgcc      3600
     cgatgcccgg cacggcaagg tgccggtgct gtggtatctt tcgggcctga cctgcacgca      3660
     tgaaaatgcc atgaccaagg ccggcgcaca ggaatgggcg gcggaatacg gcatcgcggt      3720
     gatctttccc gacacctcgc cgcgcggcga aggcgtggcc aacgacgaga cctacgacct      3780
     gggccagggc gccggcttct atgtcgatgc gaccgaggcg ccctgggcgc cgcatttcag      3840
     gatgtggcac tatgtcaccc atgaactgcc cgagctggtc ttcaacaact tcccgctgga      3900
     ccgcgaggcg cagggcatca ccggccattc catgggcggg cacggtgcgc tgaccatcgc      3960
     catgaccttc ccggagcgct atcgctcggt ctcggccttt gcgccgatcg cgcatcccag      4020
     cgaatccgac tgggggcgca aacagttcgc cgcctatctg ggcgacgaca aggcggcatg      4080
     gaaaaggcat gattcgacca tcctgatgcg cgaaaagggc tatcccggcg aggtgctgat      4140
     cgaccagggc gcgagcgacc agttcctcga tcttctgaag cccgaggcgc tggcccatgc      4200
     catggccgaa cgccgccagc ccggcacctt ccgcatgcag cagggctacg atcacagcta      4260
     tttcttcgtg caaagcttca tggccgacca tatcccgctg gcacgcggag ccttgggcta      4320
     ggcgggccgg gcccggccaa agggcaacgg ggcagggtgg gggcagggcg attgccccat      4380
     acctattgcc gaatttccct aatactttgg tccaaggagc ctgccggccg cgttgacgca      4440
     aatgcggccg gacccgaacc ttccagcagt aggtgcttgc gcatgaggag aggcgcgacc      4500
     accggcatgc ggaggaaaat tcatgaaaaa cctaatgaat ggcgcctgcc ttgcgctgct      4560
     catgtccggc actgcggcgc tggccaatga acagcgtgct ggccgagatc gccaagcccc      4620
     gcaatgggcg atccagatgg gcgattacgc gaacacgcga tattcgaccc tggaccagat      4680
     caacaaggac aacgtcaagg atctgcgcgt cgcctggacc ttctcgaccg gggtgctgcg      4740
     cggacacgaa ggctcgccgc tggtgatcgg cgatgtcatg tatgtccaca ccccctttcc      4800
     gaaccgggtg tttgcgctgg acctgaacga caacggcaag atcctgtggc gctatgaacc      4860
     gcagcaggat ccgaacgtaa ttgcggtgat gtcctgcgac acggtctatc gcggcctttc      4920
     ctatgcggac ggcatgatcc tgctgggcca ggccgacacc acggtcgtgg ccctggacgc      4980
     cacgagcggc gaggtgaaat ggtcgaccaa gatcggcgac ccgggcatcg gcgagacgct      5040
     gaccgccacc gtcgttccgg tcaaggacaa ggtcctggtc ggcatctcgg gcggcgaata      5100
     cggcgtgcgc ggccggatga ccgcgctgaa cctcaccgat ggcagcgagg cctggaaagc      5160
     ctggtccacc ggcccggacg aggagttgct ggtcgatccc gaaacgacca cgcatctggg      5220
     caagcccatc ggcgccgaca gctcgctcaa cagctgggaa ggcgatcagt ggcagatcgg      5280
     cggcggcacg atctggggct ggttctcgta tgacccggac ctgaacctgg tctattacgg      5340
     caccggcaac ccctcgacct ggaacccctc gcagcggccg ggcgacaaca agtggtcgat      5400
     gacgatcatg gcgcgggatg ccgataccgg catggccaag tggttctatc agatgacgcc      5460
     ccatgacgaa tgggactatg acggcgtcaa cgagatgatc ctgaccaacc agaccgtcga      5520
     cgggcaagag cgcaagctgc tgacccattt cgaccgcaac ggcctggcct atacgatgga      5580
     tcgcgagacc ggcgagttgc tggtggccga gaaatacgat ccggtggtga actggaccac      5640
     cggcgtcgac atggacccga attcggaaac ctatggccgt ccggccgtgg tggccgaata      5700
     ctcgaccgcc cagaacggcg aggacgagaa caccaccggc gtctgccctg cggcactggg      5760
     caccaaggac cagcagccgg cggccttctc gcccaagacc aacctgttct atgtgccgac      5820
     gaaccacgtc tgcatggatt acgagccgtt ccgggtggcc tataccgccg gccagcccta      5880
     tgtcggcgcc acgctgtcca tgtatcccgc gccgaacagc catggcggca tgggcaactt      5940
     catcgcctgg cacaacacca cgggcgagat caagtggtcc gttcccgagc agttctcggt      6000
     ctggtcgggc gctttggcta cggcgggcga cgtggtcttc tacggcacgt tggagggcta      6060
     tctgaagccc gtcgatgccc agacgggcga ggagctttac aagttcaaga ccccctcggg      6120
     catcatcggc aacgtgatga cctacgaaca tggcggcaag cagtatgtcg gcatcctgtc      6180
     gggtgtcggc ggctgggccg ggatcggcct tgccgcgggc ctgaccaatc ccaacgatgg      6240
     gcttggcgcg gtgggcggct atgcctcgct gtcgcaatat accgagctgg gcggccagct      6300
     gaccgtgttc gaactgccgg gctaatactt tggtgccgga aagcaaactg tgactcgaaa      6360
     ctgggcgccc caggggtaac cttggggcgc gccatcatct tcgggtgaca gccagggagg      6420
     aaattcatga ccagcaagac gaccgccagt cttttggcga tctgtgtcgc atgcgcggcc      6480
     tctgccatcg ccggaacggc cctttgcgca gaccgccgaa acgccccggc ccaggccggg      6540
     gcaggcgctg ccgccgccgt ctcgggcgat gcgcacgagc aaccggccgc ggaagcgccc      6600
     gccgaagagg aggaggagac gccagcggtc gccgcaacgg acggcaagct tgtgctgccg      6660
     aacggccagg acatcacccc ggaccatatg gagaacggcc ggtggtatac ggccgaggat      6720
     atcccgacct acaagatcgc cgaggacggc gcggtggatt gggcgacctt ctcgggctat      6780
     cgccgctatt ccgccgaatg ccatgtctgc cacggcccgg atggcgaggg ttcgacctat      6840
     gccccggccc tgcggaaatc ggtgctgacc atgggctatt acgatttcct ggagatcgcc      6900
     gcctcgggca agcaagaggt caacaccgcc gccaatctgg tcatgccggc ctttggcacc      6960
     aacaagaacg tctggtgcta tatcgacgac atctatgcct atctgctggc gcggggcacg      7020
     ggagacttgc cgcgcggccg cccggcgaag agagaggaca agtccgatga attcgttgcg      7080
     caggaagatt cctgcatgag cggatgagac gcgcccttac ccttgccgtc ctggcgacct      7140
     gcgccgtgct gcccgccttg gcgcaggttg ccgacctgcg ctccaagacc gagttccggg      7200
     tctgtgccga tcccgccgcg gtgccgatgt cgtcccagga cggcaagggc ttcgagaacc      7260
     gcatcgccca gcttttcgcc gaaaagctgg gcgtgccggt cgcctatacc tggttcccgc      7320
     agggtcccgg cttcatccgc aagaccctgc gcgccgggct gtgcgatgtc gtcatcggct      7380
     atgcccaggg cgacgagatg gtgcagaata ccaatcatta ctacacctcg gcctatggca      7440
     tcgtgacgcg caatgacagc ccgctggcct cggtcgaggc gctggatgat ccggcgctcg      7500
     gtggccatcc tatcggcgtg gtggcgggca cgccgcctgc aagcaacctg gcgcgggcgg      7560
     ggctggccaa gaacatgcgc ggctgggacc tgttcgtgga tcgccgggtc gaggacccgg      7620
     tgggcgacat gcttgcgcag gtgaagtcgg gcgaactggc tgccgcggtg atctggggtc      7680
     cgctggccgg accgctggtc aagcaggatc ctgaactgca attcaccccg cttctcaagg      7740
     aaagcggcgg gccgcgcatg ttctatcgca tcaccatggg cgtgcgcttg ggcgagcagg      7800
     aatggaagcg cgagctgaac agcctgatcc gccgccacca ggacgagatc gacgccatcc      7860
     tgcgcgatgc cggggtgccg ctgctggacg attacggaag gctttgaaac aatgagatgg      7920
     gcttgggcgg cgatggctgt ggttgttgcc ggcgcggcca ggcccgagcc gccaagcttt      7980
     cgccgcggct atctctacct attgaaaaac atcatctttc tggaggagtg acggatgatc      8040
     cgactgttgg ccctgacgat gggagcagcc ctggcgctgg caccggccgc cgaggcgcac      8100
     ggcccgccgc ggctgaagct ggagatgcag caaaagctgg atgccacccc ggacgaggtc      8160
     tggaccgcaa tcggcagatt cgacgacatg agctggcatc cggcgatcgc cagcctggaa      8220
     ctgaccggcg acggctcggc cgaccagccc gagacatcca cccgcgtgtt gcatctgaaa      8280
     tccgacgcag gcgacccgac catcaccgag gtcctgtcga aatggcagcc cgaaaaacac      8340
     tgctatgcct atcggatcga ggcggtcgag gtgacggtcc tgccggtgac gaattatgcc      8400
     gcgacgcttt gcgtcaagga tgagggcggc aaggccgtgg tcaactggaa gggcggcttc      8460
     tatcgcggct atccgaacaa cgagcctccg cccgaactga gcgacgaggc ggcgatcaag      8520
     gcggtaaccg gagtctatca ggccggtctc gacgcgctgg ccgaaaggtt cggcaaggcg      8580
     gaatgaccaa tccgccgcct gccggcctct tgacgagtca tgggccggca gggctggcag      8640
     gttccaggga accgccctgc tcttgccagc cctcgacccc gtcgggaaac cagatcacgc      8700
     cgcgatagcc cagcgccacg gcgcgcttgg cggcattcca gctcatccag cagtcgcgct      8760
     tgcaaaagat caccatgggc gcagccctgt cgccccccga cagccgtgcc agcccctcgg      8820
     ccagccgcgc ctgttccgcc ggggccagcc ggtcatatcc ggtatcgtaa agccaggccg      8880
     cgccgggaat ggaaagatgc ggcggttcgt tccaaaacgt gcttcgggca agccctcggg      8940
     ccgggcggtg cggggcagaa cgtcgataaa gggcacgcct tgcgcatgca gccgcatcgc      9000
     ctcggccgca tcgatcacct gcgcgccggc cagggtggcc ggggtctcgg accgataggg      9060
     ctcgccatga aagctttcgt cggtattgcc gcggatatcg accacgccgg cgcggaccgt      9120
     gtcgccgctt tcggcatcgc ggatataaag gttcagggac aggatcaggt tcgagacctt      9180
     ctgcacctcg cccgagatcg cgtaatgcgc gcccatatcg cgcgcaatgc ggctgtcgct      9240
     gccgttggac tgggtcgggt tcttgatccg cgccacctgg tcggcgggcg gatcgagcag      9300
     ggtaaaaccg cggctgcgca ggtcctcggc gatgaccgtc tcggccatct cgatgcggcg      9360
     ggtctcgtcc tcgcgcacgc cgttgatcgc gccctcggtc gaggtgtcga tgaaatgcag      9420
     gccggaacca gacggcgctg tcgggcgatg gtgcggaacc gtgagccggc                 9470
//

If you have problems or comments...

PBIL Back to PBIL home page