(data stored in ACNUC9552 zone)

EMBL: U34963

ID   U34963; SV 1; linear; mRNA; STD; ROD; 726 BP.
XX
AC   U34963;
XX
DT   03-OCT-1995 (Rel. 45, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 10)
XX
DE   Rattus norvegicus programmed cell death repressor BCL-X-Long mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-726
RX   DOI; 10.1210/en.136.1.232.
RX   PUBMED; 7828536.
RA   Tilly J.L., Tilly K.I., Kenton M.L., Johnson A.L.;
RT   "Expression of members of the bcl-2 gene family in the immature rat ovary:
RT   equine chorionic gonadotropin-mediated inhibition of granulosa cell
RT   apoptosis is associated with decreased bax and constitutive bcl-2 and
RT   bcl-xlong messenger ribonucleic acid levels";
RL   Endocrinology 136(1):232-241(1995).
XX
RN   [2]
RP   1-726
RA   Tilly J.L., Tilly K.I., Kenton M.L., Johnson A.L.;
RT   ;
RL   Submitted (28-AUG-1995) to the INSDC.
RL   Jonathan L. Tilly, Department of Obstetrics and Gynecology/Vincent Center
RL   for Reproductive Biology, Massachusetts General Hospital/Harvard Medical
RL   School, 32 Fruit Street, Boston, MA 02114, USA
XX
DR   MD5; bb26981afd5ba655c8f45e8a16aa8e54.
DR   Ensembl-Gn; ENSRNOG00000007946; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000010762; rattus_norvegicus.
DR   EuropePMC; PMC113993; 11134310.
DR   EuropePMC; PMC4717020; 14716839.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..726
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /tissue_type="ovary"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        20..721
FT                   /codon_start=1
FT                   /product="BCL-X-Long"
FT                   /note="programmed cell death repressor; Bcl-2 homolog; long
FT                   isoform of BCL-X; member of the bcl-2 gene family"
FT                   /db_xref="GOA:P53563"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="PDB:1AF3"
FT                   /db_xref="PDB:4QNQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53563"
FT                   /protein_id="AAA77686.1"
FT                   /translation="MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPER
FT                   ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVLPMAAVKQALREAGDEFELRYRRA
FT                   FSDLTSQLHITPGTVYQSFEQVVNELFRDGVNWGRIVASSSFGGALCVESVDKEMQVLV
FT                   SRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNTAPESRKGQERFNRWFLTGMTVAG
FT                   VVLLGSLFSRK"
XX
SQ   Sequence 726 BP; 181 A; 177 C; 220 G; 148 T; 0 other;
     gcccatctct attataaaaa tgtctcagag caaccgggag ctggtggttg actttctctc        60
     ctacaagctc tcccagaaag gatacagctg gagtcagttt agcgatgtcg aagagaacag       120
     gactgaagcc ccagaagaaa ctgaaccaga aagggagacc cccagtgcca tcaatggcaa       180
     cccatcctgg cacctggcgg atagccccgc ggtgaatgga gccactggcc acagcagcag       240
     tttggatgcg cgggaggtac tccccatggc agcagtgaag caagcgctga gagaggctgg       300
     cgatgagttt gaactgcggt accggagagc attcagtgat ctaacatccc agcttcatat       360
     aaccccaggg acagtatatc agagctttga acaggtagtg aatgaactct ttcgggatgg       420
     ggtaaactgg ggtcgcattg tggcctcctc ctcctttggg ggggcactgt gcgtggaaag       480
     cgtagacaag gagatgcagg tattggtgag tcggattgca agttggatgg ccacctacct       540
     gaatgaccac ctagagcctt ggatccagga gaacggcggc tgggacactt ttgtggatct       600
     ctacgggaac aatacagcac ccgagagccg gaaaggccag gagcgtttca accgctggtt       660
     cctgacgggc atgactgtgg ctggtgtagt tctgctgggc tcactcttca gtcggaagtg       720
     accaga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page