(data stored in ACNUC9552 zone)

EMBL: U34964

ID   U34964; SV 1; linear; mRNA; STD; ROD; 708 BP.
XX
AC   U34964;
XX
DT   03-OCT-1995 (Rel. 45, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 9)
XX
DE   Rattus norvegicus repressor of programmed cell death BCL-2 mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-708
RX   DOI; 10.1210/en.136.1.232.
RX   PUBMED; 7828536.
RA   Tilly J.L., Tilly K.I., Kenton M.L., Johnson A.L.;
RT   "Expression of members of the bcl-2 gene family in the immature rat ovary:
RT   equine chorionic gonadotropin-mediated inhibition of granulosa cell
RT   apoptosis is associated with decreased bax and constitutive bcl-2 and
RT   bcl-xlong messenger ribonucleic acid levels";
RL   Endocrinology 136(1):232-241(1995).
XX
RN   [2]
RP   1-708
RA   Tilly J.L., Tilly K.I., Kenton M.L., Johnson A.L.;
RT   ;
RL   Submitted (28-AUG-1995) to the INSDC.
RL   Jonathan L. Tilly, Department of Obstetrics and Gynecology/Vincent Center
RL   for Reproductive Biology, Massachusetts General Hospital/Harvard Medical
RL   School, 32 Fruit Street, Boston, MA 02114, USA
XX
DR   MD5; fe8438f20cf3aa4a36ab66a5adac711d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..708
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /dev_stage="immature (27-day)"
FT                   /tissue_type="ovary"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        1..>708
FT                   /codon_start=1
FT                   /product="BCL-2"
FT                   /note="repressor of programmed cell death; proto-onocgene;
FT                   sequence lacks translation stop codon"
FT                   /db_xref="GOA:P49950"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013278"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49950"
FT                   /protein_id="AAA77687.1"
FT                   /translation="MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRRAPT
FT                   PGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRR
FT                   YRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
FT                   YPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWQSLKTLLSLAL
FT                   VGACITLGAYLGHK"
XX
SQ   Sequence 708 BP; 130 A; 207 C; 223 G; 148 T; 0 other;
     atggcgcaag ccgggagaac agggtatgat aaccgggaga tcgtgatgaa gtacatccat        60
     tataagctgt cacagagggg ctacgagtgg gatactggag atgaagactc cgcgcccctg       120
     aggcgtgccc ccacccctgg catcttctcc ttccagcctg agagcaaccg gacgcccgct       180
     gtgcaccgag acacggctgc caggacgtcg cctctacggc cccttgtcgc caacgctggg       240
     cctgcgctca gccctgtgcc acctgtggtc cacctgaccc tccgccgggc tggggatgac       300
     ttctctcgtc gctaccgtcg cgactttgca gagatgtcca gtcagctgca cctgacgccc       360
     ttcaccgcga ggggacgctt tgccacggtg gtggaggaac tcttcaggga tggggtgaac       420
     tgggggagga ttgtggcctt ctttgagttc ggtggggtca tgtgtgtgga gagcgtcaac       480
     agggagatgt accccctggt ggacaacatc gctctgtgga tgactgagta cctgaaccgg       540
     catctgcaca cctggatcca ggataacgga ggctgggatg cctttgtgga actatatggc       600
     cccagcatgc gacctctgtt tgatttctcc tggcagtctc tgaagacgct gctcagcctg       660
     gccctggtgg gggcctgcat cactctgggt gcatacctgg gccacaag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page