(data stored in SCRATCH zone)

EMBL: U36245

ID   U36245; SV 1; linear; genomic DNA; STD; PRO; 1993 BP.
XX
AC   U36245;
XX
DT   16-NOV-1995 (Rel. 45, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Bacillus subtilis biotin carboxyl carrier protein (accB) and biotin
DE   carboxylase (accC) genes, complete cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1993
RX   PUBMED; 8102363.
RA   Gornicki P., Scappino L.A., Haselkorn R.;
RT   "Genes for two subunits of acetyl coenzyme A carboxylase of Anabaena sp.
RT   strain PCC 7120: biotin carboxylase and biotin carboxyl carrier protein";
RL   J. Bacteriol. 175(16):5268-5272(1993).
XX
RN   [2]
RX   PUBMED; 7909542.
RA   Norman E., De Smet K.A., Stoker N.G., Ratledge C., Wheeler P.R., Dale J.W.;
RT   "Lipid synthesis in mycobacteria: characterization of the biotin carboxyl
RT   carrier protein genes from Mycobacterium leprae and M. tuberculosis";
RL   J. Bacteriol. 176(9):2525-2531(1994).
XX
RN   [3]
RX   PUBMED; 7592499.
RA   Marini P., Li S.J., Gardiol D., Cronan J.E.Jr., de Mendoza D.;
RT   "The genes encoding the biotin carboxyl carrier protein and biotin
RT   carboxylase subunits of Bacillus subtilis acetyl coenzyme A carboxylase,
RT   the first enzyme of fatty acid synthesis";
RL   J. Bacteriol. 177(23):7003-7006(1995).
XX
RN   [4]
RP   1-1993
RA   Marini P.;
RT   ;
RL   Submitted (13-SEP-1995) to the INSDC.
RL   Patricia E. Marini, Promubie -Universidad De Rosario, Microbiologia,
RL   Suipacha 531, Rosario, Santa Fe, Argentina, 2000
XX
DR   MD5; 848b6ee7fd319ee32c902547da54ca3f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1993
FT                   /organism="Bacillus subtilis"
FT                   /map="218"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /clone="lambdaDM10-lambdaDM11-lambdaDM14"
FT                   /db_xref="taxon:1423"
FT   regulatory      83..87
FT                   /gene="accB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        98..577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /product="biotin carboxyl carrier protein"
FT                   /db_xref="GOA:P49786"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49786"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAB00182.1"
FT                   /translation="MLNIKEIHELIKAIDESTIDEFVYENEGVSLKLKKHEAGTVQVMQ
FT                   QAPAAPVQAQAPQAVQPQGEQAAAPAQEAPKQDENLHKITSPMVGTFYASSSPEAGPYV
FT                   TAGSKVNENTVVCIVEAMKLFIEIEAEVKGEIVEVLVENGQLVEYGQPLFLVKAE"
FT   regulatory      577..581
FT                   /gene="accC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        589..1935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /product="biotin carboxylase"
FT                   /function="acetyl-CoA carboxylase subunit"
FT                   /db_xref="GOA:P49787"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49787"
FT                   /protein_id="AAB00183.1"
FT                   /translation="MIKKLLIANRGEIAVRIIRACRELGIETVAVYSEADKDALHVQMA
FT                   DEAFCIGPKASKDSYLNVTNIVSVAKLTGTDAIHPGYGFLAENADFAELCEEVNVTFVG
FT                   PSADAISKMGTKDVARETMKQAGVPIVPGSQGIIENVEEAVSLANEIGYPVIIKATAGG
FT                   GGKGIRVARTEEELINGIKITQQEAATAFGNPGVYIEKYIEDFRHVEIQVLADNYGNTI
FT                   HLGERDCSIQRRLQKLLGESPSPALGSEIREQMGDAAVKAAKAVGYTGAGTVEFIYDYN
FT                   EQRYYFMEMNTRIQVEHPVTEMVTGTDLIKEQIKVASGMELSLKQEDVEFEGWAIECRI
FT                   NAETQVKFMPSPGEINVPASGGLGVRVDSAAYPGYSIPPYYDSMIAKVITYGKTRDEAI
FT                   ARMKRALQQFVIEGIETTIPFHLKLLEHETFVSGEFNTKFLETYDVMGS"
XX
SQ   Sequence 1993 BP; 654 A; 400 C; 480 G; 459 T; 0 other;
     ttgaattcaa aagtccgcct cctgtaagat gaacatagta tgtactttta gtagtaacct        60
     ataaaaaaag aaatttcata cataggagtg cgattgaatg ttaaatatca aagaaatcca       120
     cgagctgatt aaagcaattg acgagtctac aattgacgaa ttcgtatatg aaaatgaagg       180
     tgtatcctta aaactgaaaa aacacgaagc aggcacggtt caagtcatgc agcaggcacc       240
     ggcagcacct gtacaagcac aggctccgca ggcagttcag cctcaaggcg agcaagcagc       300
     ggcacctgcc caagaagcac caaagcaaga tgagaatctg cataaaatca cttcaccaat       360
     ggtaggaaca ttttatgctt cttcatcacc ggaagctggc ccgtatgtaa cagccggttc       420
     aaaagtaaat gaaaacacag ttgtctgcat tgtagaagcg atgaagcttt tcatcgaaat       480
     cgaagcagaa gtgaaaggcg aaatcgttga agtattagta gaaaacggtc agctggtcga       540
     atacggacaa cctctatttc ttgtaaaagc ggagtaagga gacttaacat gattaaaaag       600
     ctattgatcg ccaacagagg agaaattgct gtcagaatca tcagagcctg cagagagctc       660
     ggaattgaga ctgtcgctgt ttattcagaa gctgataaag atgcccttca tgttcaaatg       720
     gccgatgaag ctttttgtat cggaccgaaa gcatcaaaag acagctattt aaacgttaca       780
     aatattgtga gtgttgcaaa gctgactggc acggacgcca ttcatccggg atacggattt       840
     ttagctgaaa atgctgattt cgctgaatta tgtgaagaag ttaatgtcac gtttgtcggc       900
     ccgagcgctg acgccatttc aaaaatggga acaaaagacg ttgcgcggga aacgatgaaa       960
     caggccggcg tgccaatcgt accgggttca cagggaatta tagaaaatgt ggaagaagcg      1020
     gtttcgcttg ctaatgaaat tgggtatcct gtaattataa aagccaccgc aggcggaggc      1080
     ggaaaaggaa tcagggttgc ccgtactgaa gaggaactga ttaatggcat taagattaca      1140
     cagcaggaag cggcaactgc atttgggaat ccaggtgtat acatcgaaaa atacatagaa      1200
     gattttcgcc acgttgagat ccaagtgctt gctgataact acggaaatac gatccatttg      1260
     ggcgaacgcg actgctcgat ccaaagacgc ctgcaaaagc ttttgggaga atcaccatct      1320
     cctgcccttg gttcagaaat cagggagcaa atgggagatg cagcggtaaa ggctgcaaaa      1380
     gcggttggct atacaggtgc tggaacagtt gaatttatct atgactacaa tgaacagcgc      1440
     tattacttca tggaaatgaa cacgagaatt caggtagagc acccagtcac agaaatggtg      1500
     acgggcactg acctgatcaa ggaacaaatc aaagtagcat caggaatgga actgagcctc      1560
     aagcaagaag atgttgaatt tgaaggctgg gccatcgaat gccgaatcaa cgcagaaacc      1620
     caagttaaat tcatgccgtc acctggcgaa ataaatgtac ctgcctctgg cggtcttggt      1680
     gtccgtgtcg attcagctgc gtaccctggc tattccatcc caccgtacta tgacagcatg      1740
     attgcaaagg taatcacata cggaaaaacg agggatgaag cgattgctcg catgaagcgc      1800
     gcattgcagc aattcgtcat cgaaggcatt gagacaacaa tccctttcca tttaaaactg      1860
     cttgaacacg aaacatttgt gagcggagag tttaatacga aatttttaga aacatatgat      1920
     gtaatgggct cataattttt acggaggctg aatctgtaac tgacaagaca acagcttgct      1980
     taaatggaat cac                                                         1993
//

If you have problems or comments...

PBIL Back to PBIL home page