(data stored in ACNUC22857 zone)

EMBL: AH006641

ID   AH006641; SV 3; linear; genomic DNA; STD; HUM; 10968 BP.
XX
AC   AH006641; AF379038-AF379039; U36249-U36268;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens chromosome 22 beta-prime-adaptin (AP1B1) gene, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-139,240-691,792-1236,1337-1910,2011-2470,2571-3055,3156-3544,3645-4101,
RP   4202-4447,4548-4886,4987-5380,5481-5845,5946-6346,6447-6798,6899-7219,
RP   7320-7617,7718-8045,8146-8899,9000-9154,9255-9506,9767-10968
RX   DOI; 10.1093/hmg/3.8.1393.
RX   PUBMED; 7987321.
RA   Peyrard M., Fransson I., Xie Y.G., Han F.Y., Ruttledge M.H., Swahn S.,
RA   Collins J.E., Dunham I., Collins V.P., Dumanski J.P.;
RT   "Characterization of a new member of the human beta-adaptin gene family
RT   from chromosome 22q12, a candidate meningioma gene";
RL   Hum. Mol. Genet. 3(8):1393-1399(1994).
XX
RN   [2]
RP   1-139,240-691,792-1236,1337-1910,2011-2470,2571-3055,3156-3544,3645-4101,
RP   4202-4447,4548-4886,4987-5380,5481-5845,5946-6346,6447-6798,6899-7219,
RP   7320-7617,7718-8045,8146-8899,9000-9154,9255-9506,9767-10968
RX   DOI; 10.1006/geno.1996.0431.
RX   PUBMED; 8812422.
RA   Peyrard M., Pan H.Q., Kedra D., Fransson I., Swahn S., Hartman K.,
RA   Clifton S.W., Roe B.A., Dumanski J.P.;
RT   "Structure of the promoter and genomic organization of the human
RT   beta'-adaptin gene (BAM22) from chromosome 22q12";
RL   Genomics 36(1):112-117(1996).
XX
RN   [3]
RP   1-10968
RA   Peyrard M., Swahn S., Kedra D., Fransson I.;
RT   ;
RL   Submitted (12-SEP-1995) to the INSDC.
RL   M. Peyrard, Dept. of Molecular Medicine, Clinical Genetics Unit, Karolinska
RL   Hospital, Building L-6, Stockholm, S-171 76, Sweden
XX
DR   MD5; e2a4bd5d1303fa9e4920163aaf5b2e75.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:1532097, gi:1532098, gi:1532099, gi:1532100, gi:1532101,
CC   gi:1532102, gi:1532103, gi:1532104, gi:1532105, gi:1532106,
CC   gi:1532107, gi:1532108, gi:1532109, gi:1532110, gi:1532111,
CC   gi:1532112, gi:1532113, gi:1532114, gi:14043006, gi:14040077,
CC   gi:14040080, gi:1532116, gi:14043005.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10968
FT                   /organism="Homo sapiens"
FT                   /chromosome="22"
FT                   /map="22q12"
FT                   /mol_type="genomic DNA"
FT                   /note="cDNA sequence for the AP1B1 gene presented in
FT                   GenBank Accession Number L13939"
FT                   /db_xref="taxon:9606"
FT   gene            1..10968
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT   mRNA            join(<1..18,376..439,1040..1145,1483..1618,2134..2379,
FT                   2664..2854,3223..3444,3719..3839,4265..4360,4714..4829,
FT                   5060..5225,5621..5719,6012..6271,6519..6720,7124..7144,
FT                   7400..7543,7850..7995,8258..8387,8641..8725,9068..9154,
FT                   9255..9409,9634..9642,9931..10968)
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /product="beta-prime-adaptin"
FT   exon            <1..18
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=1
FT   gap             140..239
FT                   /estimated_length=unknown
FT   exon            376..439
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=2
FT   CDS_pept        join(403..439,1040..1145,1483..1618,2134..2379,2664..2854,
FT                   3223..3444,3719..3839,4265..4360,4714..4829,5060..5225,
FT                   5621..5719,6012..6271,6519..6720,7124..7144,7400..7543,
FT                   7850..7995,8258..8387,8641..8725,9068..9154,9255..9409,
FT                   9634..9642,9931..10005)
FT                   /codon_start=1
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /product="beta-prime-adaptin"
FT                   /note="candidate meningioma tumor suppressor"
FT                   /protein_id="AAC50684.2"
FT                   /translation="MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGK
FT                   DVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLD
FT                   TLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFI
FT                   LDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLL
FT                   KKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHK
FT                   PPSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNL
FT                   DLGPPVSGPPLATSSVQMGAVDLLGGGLDSLMGDEPEGIGGTNFVAPPTAAVPANLGAP
FT                   IGSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGSISMDLQLTN
FT                   KALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNL
FT                   QVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAE
FT                   AASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTDLELSLKC
FT                   RAPEVSQHVYQAYETILKN"
FT   gap             692..791
FT                   /estimated_length=unknown
FT   exon            1040..1145
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=3
FT   gap             1237..1336
FT                   /estimated_length=unknown
FT   exon            1483..1618
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=4
FT   gap             1911..2010
FT                   /estimated_length=unknown
FT   exon            2134..2379
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=5
FT   gap             2471..2570
FT                   /estimated_length=unknown
FT   exon            2664..2854
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=6
FT   gap             3056..3155
FT                   /estimated_length=unknown
FT   exon            3223..3444
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=7
FT   gap             3545..3644
FT                   /estimated_length=unknown
FT   exon            3719..3839
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=8
FT   gap             4102..4201
FT                   /estimated_length=unknown
FT   exon            4265..4360
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=9
FT   gap             4448..4547
FT                   /estimated_length=unknown
FT   exon            4714..4829
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=10
FT   gap             4887..4986
FT                   /estimated_length=unknown
FT   exon            5060..5225
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=11
FT   gap             5381..5480
FT                   /estimated_length=unknown
FT   exon            5621..5719
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=12
FT   gap             5846..5945
FT                   /estimated_length=unknown
FT   exon            6012..6271
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=13
FT   gap             6347..6446
FT                   /estimated_length=unknown
FT   exon            6519..6720
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=14
FT   gap             6799..6898
FT                   /estimated_length=unknown
FT   exon            7124..7144
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=15
FT   gap             7220..7319
FT                   /estimated_length=unknown
FT   exon            7400..7543
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=16
FT   gap             7618..7717
FT                   /estimated_length=unknown
FT   exon            7850..7995
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=17
FT   gap             8046..8145
FT                   /estimated_length=unknown
FT   exon            8258..8387
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=18
FT   exon            8641..8725
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=19
FT   gap             8900..8999
FT                   /estimated_length=unknown
FT   exon            9068..9154
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=20
FT   gap             9155..9254
FT                   /estimated_length=unknown
FT   exon            9255..9409
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=21
FT   gap             9507..9606
FT                   /estimated_length=unknown
FT   exon            9634..9642
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=22
FT   gap             9667..9766
FT                   /estimated_length=unknown
FT   exon            9931..10968
FT                   /gene="AP1B1"
FT                   /gene_synonym="BAM22"
FT                   /number=23
XX
SQ   Sequence 10968 BP; 1754 A; 2713 C; 2475 G; 1926 T; 2100 other;
     gagctattgg gacctgcggg tgaggaagcg gggacccggg cgagccagga gaagaagtgg        60
     ggcgaggggt caggggtcct aggtgagggg tttgcggggt cagaggtcat gaagaggacg       120
     cggcgctgca ggggcgcgan nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnt       240
     tgtttctcca ggaaatagat aagcagctgt tttcctgtac cacatgtgtt ctggatcctt       300
     ctcctccctc tgcaccataa ctgaagatgg gatggagcat aactgaaagt cacccctctc       360
     ttctctctct tgcagaagcc tggctacaga taagggacca aaatgactga ctcaaaatat       420
     ttcaccacga ccaagaaagg tattacttgt ttaataatgg gccttgtcct atgctttctc       480
     ttcctgtccc ttctgttttc ctcctatggc ggtagggagt aggggtggga atgaaggcct       540
     ggaaacatgt ggcaggaatg gcctagagct tgtggtagat ctagaaaatt gaactgttga       600
     tgatataaga aattgaccac tccttttaga gctcagaaag ggaagaacat tagctccaag       660
     tgtggggaaa aaaagtgccc ttttatttcc cnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       780
     nnnnnnnnnn ntaaagtgct gggattacag gtatgagcga ctgcacccgg cctacaagtt       840
     tccatcttgt taattcctgt cctaacagtc atccctcact gttgcctggc ccacctgagg       900
     ccaggcgcct gaagcttccc tcagccaaca gcataggatg tcttacgtgc ctccctccgg       960
     ttcttttgga agttagatac tgggaattgt cccctgccag ggtagggagg gatcactcat      1020
     gcttgcctcc tttccttagg ggagatcttc gagctgaagg cagagctcaa cagtgacaag      1080
     aaggagaaga agaaggaggc agtgaagaaa gtgattgcat cgatgaccgt gggcaaagat      1140
     gtcaggtgtg caggagtagg cctggtggca gctagaagct ggctgacagg ggagggttta      1200
     tagcttgggt ccacttcagt ctctccttta gggtgtnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnctga aaccctccct tttaccagga agtccagtgt gtctctcctt      1380
     tctctcctac ccactgtcct ctcacccact agttagcagc ctgaaaatct tcctcttcct      1440
     ttgttcagcc tttcccatgc tgacaccatt ttgaccttcc agtgccctct tccccgatgt      1500
     ggtcaactgc atgcagacgg acaacctgga gctgaagaag ctggtatacc tctacttgat      1560
     gaattacgcc aagagtcagc ctgacatggc cattatggcc gtcaacacct ttgtgaaggt      1620
     gagcagacgc ttggtgggcg tggggacatt gggtgcttaa ggctctgtct cccctcagtc      1680
     tctttggggc ggggccctgt ggcactggat ggagtccaga ccttcagact gcccgcgccc      1740
     gcccagcctg caggcctctt cctccagcag agggctccca ctctccagaa aatcagatgc      1800
     taaggaccct gcgtaactca tcctgtgtga ggtcctgcca ggcctgttga tcccctcact      1860
     gccctgattg gaccctgccc tgcatgcttt gctagggcag gaatcagcag nnnnnnnnnn      1920
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1980
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn gatccacagc agccatctga tgtcgctcag      2040
     cctagcaggg ctcagagctg caggccaggg agaatatgaa gccacagatg gctcatccca      2100
     cccctgccct ggccgatggc tggttccccc caggactgtg aggaccccaa ccccctcatc      2160
     cgagccctgg cagtgcggac catgggctgc atccgcgttg acaagatcac agagtacctg      2220
     tgcgagccac tccggaagtg cctgaaggac gaggatccat atgtgcgcaa gacagcagct      2280
     gtgtgcgtgg ccaagctcca cgacatcaac gcccagctgg tggaggacca gggcttcctg      2340
     gacaccctta aagacctcat ctccgactct aaccccatgg taagccactg ccacccaccg      2400
     tgctacctcc accacctcct gggttgcttg ggaagacatt ggcttgactc ttcaccaggc      2460
     agtcctgagt nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2520
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn atttgacctc      2580
     tgaccagcca gcatcattaa tgcactcccc cctggcctgt gagcagcacc cccagcctct      2640
     gcccctccca ccctctcaac caggtggtgg ccaatgcagt ggcagcgctc tcagaaattg      2700
     ccgagtctca ccccagcagc aacctgctcg atctgaaccc acagtccatc aacaagctgc      2760
     tgacagccct caatgagtgc accgagtggg gccagatctt catcctggac tgcctcgcca      2820
     actatatgcc caaggacgac cgcgaggccc agaggtgagc gggctgcccg ttgcttgcca      2880
     gcccagcttg aggaccctgg tcctcagggg ctccaaccag gcactgggcc ttgggcctta      2940
     gtgggcccct ttctagtgct ttgccccata acccaccctc agacacacct aaagggaggc      3000
     ctgcctgctt cccacctctc cagagccagg tagacaggag agttgccttg ggcagnnnnn      3060
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtaa ctaaaaacag aatgtttccc      3180
     cttgtctttc ctgtttgccc cgttggaatg gacggacccc agcatctgtg agcgggtcac      3240
     ccccaggctc tcccatgcca actccgctgt ggtgctctct gctgtgaagg tgctgatgaa      3300
     gttcatggag atgttgtcta aggacttgga ctactacggc acactgctca agaagctggc      3360
     cccacccctg gtcacactgc tgtcagccga gccagagctg cagtatgtgg ccctgcgcaa      3420
     catcaatctc atcgtgcaga aaaggtactg aggtcaccac acgcacgtcc atgcgtaccc      3480
     ctcggggagc ctcttctgtt gggaatgggg gctctcaaag gaaactgacc tgtcaccatg      3540
     caggnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnncaaatg tggagggcat      3660
     tttctcacag ggcttaagcc ttgttttttg ctctccgggc atcctgcccc accaccaggc      3720
     ctgagatcct gaagcatgag atgaaggtgt tcttcgtgaa gtacaacgac cctatctacg      3780
     tgaagctgga gaagctggac atcatgatcc gcctggcctc tcaggccaac atcgcccagg      3840
     tcagctgcgt gtgatggtca ggacacgggc tcagtgtggg accattccac caccaccaga      3900
     ctgtaggctc tggcccaggt gaccagtctc accattaacg gtttatctca tgaagagtgt      3960
     ttagcatggg acatggggct tcgtaagcaa gtaaaagaac tgatgttttt attactaaag      4020
     aatgtttctc catgttatca cctgtcatcc cttacaacgt ggtgttggat atgttagcta      4080
     aatcaacccc aaacaaggtt gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4200
     nggagtgttc cagcagattg tcccatcagg tgccccagcc ccatcttttc tgtttgggcc      4260
     acaggtgttg gcagagctga aagagtacgc aacagaagtg gatgtggact ttgtacggaa      4320
     ggctgtgcgt gctattggcc gctgcgccat caaggtggag gtgaggctct gggactctgt      4380
     ccttggctgg agaaggaaaa gggggctgaa accgggaaac cagtctgatt caagcagaat      4440
     ctgccagnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnact ggttctctcc      4560
     tgttacctgg ggagagggtt ctcctgtttt cccactgtga tgaggaaggt gtgccagaag      4620
     tgatttgcag cccttggccg aggcgtggac atcagaggct ctactggaaa tggggtgcgg      4680
     ggacctcgcc cacactcttc tcttcccatg cagcaatctg cggagcgctg tgtgagcacg      4740
     ctgctcgacc tcatccagac caaggtcaac tatgtggtcc aggaggccat cgtggtcatc      4800
     aaggacatct tccgcaagta ccccaacaag tgcgtgcccg ccctcctagg gagagggcat      4860
     ctagctctgc ctggggacag ggatggnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4920
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4980
     nnnnnnaccc ctgtctggct tccctgggtt tcccgttctc cttgagggct cccataccaa      5040
     ctgtgccctg gtctcccagg tatgagagtg tgattgccac actgtgtgag aatctggact      5100
     ccctggatga gcctgaggcc cgggctgcca tgatctggat tgtgggcgag tacgcggaac      5160
     ggatcgacaa cgcagatgag ctgctggaga gcttcctcga gggcttccat gacgagagca      5220
     cacaggtgag ccagcgagct ggccagggtg tgagtcatga ctggcagctc agccccactg      5280
     tggcccatac tgccatgaaa ccctcccttc ctattacctc gtaaacagcc ctgacagaca      5340
     gatgagtgat gtgcgcgtaa tggacaccgc cccttttcct nnnnnnnnnn nnnnnnnnnn      5400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5460
     nnnnnnnnnn nnnnnnnnnn ccgtgacagc cccaaaccta gaataactat gcttggcttc      5520
     cagggacttt gaacacccta ttcctcttca agcctttttg ttctccctct atccccatgt      5580
     gaggcccaca cttcctcctc gtcaccgctg ttccctgcag gtccagctgc agctgctgac      5640
     agccattgtg aaactctttc taaagaagcc aacagagacc caggagctgg tgcagcaggt      5700
     cctcagtttg gccactcagg tgggtgcccc aacctccccg ctgtgcccag catagccctc      5760
     actcaagcag gggaactttt gtcccaggaa ctagacctgg aagccaggcc cgctcctaag      5820
     acaggtatct tgtgggtggg actggnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5880
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5940
     nnnnnaggaa ggtctcctcc cttctcacct ggctactctg agtttcatgg gcttctcctc      6000
     acccccacaa ggactcagat aacccagacc tgcgggaccg tggctacatc tactggcgcc      6060
     tgctgtccac ggacccggtg gcagccaagg aggtggtgtt ggctgagaag ccactcatct      6120
     ctgaagagac ggacctcatc gagcccacac tgttagacga gcttatctgc tacatcggca      6180
     cgctggcttc cgtctaccat aagcctccca gtgcctttgt ggaggggggc cggggcgtcg      6240
     tgcacaagag cctgccacct cgcacggcct cgtgagtgag actggccagt cggcctgcgc      6300
     cttcacactc tgcttcccca gtttagcagc acaggcactc aggcctnnnn nnnnnnnnnn      6360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6420
     nnnnnnnnnn nnnnnnnnnn nnnnnncctg gaggctgggg tctctttgac cttcctgaga      6480
     catcctgatg cctccaccct acttctgtgt cccggcagga gtgagagcgc agagagccct      6540
     gagacagccc ctactggagc acctcctggg gagcagccag atgtcatccc cgcccagggc      6600
     gacctgctgg gtgacctcct caacctggac ctcggccccc cagtgagcgg cccacccctg      6660
     gccacctcct cggtgcagat gggagctgtg gaccttcttg gcggtggcct tgacagcctg      6720
     gtatgttgtg ggccccctct ggatgatgtt gataatgatc ctcagaggag cagtcactga      6780
     atgcccctcc atgccaggnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnct      6900
     gtggtgcagg acaggtgttg gggtaaaggt gtggggtagt gcctttcata gagacagggt      6960
     ctgggcctct cgccagacct cacaccacac tcctctcgga tggagctacc gttgactaat      7020
     ctccctcttt cccttctctc tcttgtttct ctgtcttcct tcctggcttt ttctctctgc      7080
     atgtggctgc ctgttctctt cacctgcctg cttctgcttg gagatggggg atgagcctga      7140
     aggggtatgg ttcaaccctt gcgtcaccaa gccttcgtcc ttgctcctcc cgaaagcgct      7200
     ggcccagcat cccaaggggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnc      7320
     caggtggctc tactcattcc cagaccctga tgtctttgcc tcttgacgcc cacctctgac      7380
     tctttccctc cctttccaga ttgggggcac caacttcgtg gcacctccaa cagcagcagt      7440
     accagccaat cttggagcac ccatcggcag tggcctgagt gacctctttg acctgaccag      7500
     tggcgtgggc accctgtcag gatcatatgt ggcccccaaa gcagtaagtc acttgtcttc      7560
     tgtcttggcg ggagcagaga gaagttatgg agactggcat gtgggctcct ttaaatgnnn      7620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7680
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnngta aaggtggggg tgctggatct      7740
     gggaggcccc tgcaggagag agagagaaaa agcaccctca ggtgggctgt tgagtttggg      7800
     ctgcaggaag aggcacctac ccgccccctc cgcaccctct tccctgcagg tctggctccc      7860
     agccatgaag gctaaggggc tggagatctc aggcaccttc acccgccagg tgggctccat      7920
     ctccatggac ctgcagctga ccaacaaggc cttgcaggtc atgaccgact ttgccatcca      7980
     gttcaaccgc aacaggtgag agctccctga ggccagcgca cctctcaaga ggaggcctgt      8040
     gagagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      8100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtga gaggctccct      8160
     gccaaccaca gccccagctc ccgagtcgga ggagctcacc tgtcccgcat cagcacctac      8220
     tccccctgcc atccctgtgg ggcttctctc tccccagctt tggcctggcc cccgccgccc      8280
     ccctccaggt ccacgcgcca ctcagcccca accagacagt ggagatctcc ctgcctctca      8340
     gcacggtggg ctcggtcatg aagatggagc ctctgaacaa cctccaggtg ggttccgggc      8400
     agggcaggca ccccagtcct tactcaccta ccagccgggc cccactgggg tcagtagaag      8460
     gtcgtgtctg cggagtcatg ctcttagctg cagatgtgtt ggggaggccc aggttgggga      8520
     acgaaggggt gtgtttacca gggaaggccc tgggagagaa tctgctcagt gacactcttc      8580
     ctggggcctc agaggtggcg tcaagcccca gagactgact ggggaccccc ttgtgcctag      8640
     gtggccgtga agaacaacat cgatgtcttc tacttcagca ccttgtaccc actgcacatc      8700
     ctctttgtgg aggacgggaa gatgggtgag tcatgaggga gcccgctggg gtgcctgaaa      8760
     tggggctgtg gcttgggaac ctggccaagg tggtgccttt accaaggtcc agatggactg      8820
     ccttgcccgt aaatggagtc ggggagttgc tgcttccctg cagggcctgg agtgaggggt      8880
     atacccagga cccccccggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      8940
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnc      9000
     tgagctacag agggcccaca ggtttatgag gggctcgcct ctcatcccca ccctgctcac      9060
     cccgcagacc ggcagatgtt cctggccaca tggaaggata ttcccaatga gaatgaggcc      9120
     cagttccaga tcagagactg ccccctcaat gcagnnnnnn nnnnnnnnnn nnnnnnnnnn      9180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9240
     nnnnnnnnnn nnnnaggctg cgagcagcaa gctgcagagc agcaacatct tcactgtcgc      9300
     caagaggaac gtggagggcc aggacatgct ctaccagtcc ctgaagctga ccaacggcat      9360
     ctgggtgctg gcggagctgc ggatccagcc gggcaacccc agctgcacgg tgagagcccc      9420
     ggcacccgcc ctgcagcctt ggagcctccc cttcgtccca tgccaggggg tggccctggt      9480
     ggaggacgcg gtccaagcgt cccttcnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9600
     nnnnnnagcg tagtcacctt gccctcaggt cctgacttag aggagctcca aggaccctcc      9660
     tggctcnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnncgcc ccctccgctt      9780
     tacctcacat ctgtgccagg cgcagctgcc gccaggctgt gtgcactcca cgctgtccca      9840
     ttggttcctg ctctcttccc cacccctttc cttcctgaga ggaaccccag ggatgagcgc      9900
     tctttccccc gacccctctc tcccctgcag ctgtccctga agtgtcgagc accagaggtg      9960
     tcccagcacg tgtaccaggc ctacgagacc atcctcaaga actgagaccc cggccagcgc     10020
     ccaccccagc cttctgcccg ccccatcgag gaggcccctc gggggcagca catcttcctc     10080
     ctcgcaggag ggaccaggcg gggctccagg ccactcagtg ggctccctgg tcctgatggc     10140
     agaacccacc cgatccctgg ggtagggcac caccccctcc tggggtgaga gcgcagtgca     10200
     ctcccgtgct ctgggacacc cctgctcctg tggctgtgat gtggggttaa gtgaggtggg     10260
     gaccaaagga aacagagcca gagcagccac agaagctgtg cctgaagggt gagtgtggag     10320
     cttgcccctc cggctcacag ccccggcagc ccctggctcc ttggtctctc cggttggtgt     10380
     taaagggccc tccactgcca cctctcatgg gatggaccct gccaacctgg cctgggtgtg     10440
     cagggagggg ttccccttgg taccaggaga gctgctcact tagggcctgg ggctcaagga     10500
     gctgtaggtg ccggcagagg ggcagagcta ggctgggagg agcccagggc ctgcaccacc     10560
     cacttgcaac caccaggctg gtgccctgca gctgtgccag ttgggccaca gcctcccgag     10620
     tgctgaccca catggtcaag accaggcaga agctcccaga gcccctgtct cgggctcccc     10680
     accgactggc agctgcacta tccccaactc cccacttctg ccccaagggt ggtcactgcc     10740
     tgtgatacat tcctcagtgt cgcctctgag cccaggcctc ctgccacaaa gactgggccg     10800
     agagatgggg ctgggtaagc gggtgcgcct cctgtttggg tttcttcggg gtttctctgt     10860
     agtgtctgct gccctcctcc tggcctccca ggtttcagtt gtgtctgaca gagcattagg     10920
     ttttcctgtt actgctgtgt aataataaag aaagattcgg cttttggc                  10968
//

If you have problems or comments...

PBIL Back to PBIL home page