(data stored in ACNUC8465 zone)

EMBL: U39064

ID   U39064; SV 1; linear; mRNA; STD; HUM; 1519 BP.
XX
AC   U39064;
XX
DT   02-MAR-1996 (Rel. 47, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Human MAP kinase kinase 6 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1519
RX   DOI; 10.1074/jbc.271.6.2886.
RX   PUBMED; 8621675.
RA   Han J., Lee J.D., Jiang Y., Li Z., Feng L., Ulevitch R.J.;
RT   "Characterization of the structure and function of a novel MAP kinase
RT   kinase (MKK6)";
RL   J Biol Chem 271(6):2886-2891(1996).
XX
RN   [2]
RP   1-1519
RA   Han J.;
RT   ;
RL   Submitted (23-OCT-1995) to the INSDC.
RL   Jiahuai Han, Immunology, The Scripps Research Institute, 10666 N. Torrey
RL   Pines Rd., La Jolla, CA 92037, USA
XX
DR   MD5; b3e25d6fd9909f35938c8c12dccc82b6.
DR   Ensembl-Gn; ENSG00000108984; homo_sapiens.
DR   Ensembl-Tr; ENST00000589647; homo_sapiens.
DR   Ensembl-Tr; ENST00000590474; homo_sapiens.
DR   Ensembl-Tr; ENST00000613873; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1519
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        405..1241
FT                   /codon_start=1
FT                   /product="MAP kinase kinase 6"
FT                   /note="protein kinase"
FT                   /db_xref="GOA:P52564"
FT                   /db_xref="H-InvDB:HIT000219620.14"
FT                   /db_xref="HGNC:HGNC:6846"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:2Y8O"
FT                   /db_xref="PDB:3ENM"
FT                   /db_xref="PDB:3FME"
FT                   /db_xref="PDB:3VN9"
FT                   /db_xref="PDB:5ETF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52564"
FT                   /protein_id="AAB03708.1"
FT                   /translation="MELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLD
FT                   ISMRTVDCPFTVTFYGALFREGDMWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAV
FT                   SIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPY
FT                   MAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQL
FT                   PADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD"
XX
SQ   Sequence 1519 BP; 447 A; 290 C; 361 G; 421 T; 0 other;
     gcagagtgtt gctgtgtgtg cttgtgattt gtattttatt tgatgtaaac gtgaaggcag        60
     agtattttct aacactgtaa ttcaactagg ttttgtgtct cctggatcta tttttttttc       120
     ttgttgttct gaggagctga tatacttgga aatattaggt ttaagatatg cagatgtcca       180
     acttatatac atagtcaagg gtttagagtc tggagacagg aggctggcaa tttcaactag       240
     ggggcaggtc aggcaagaag cgaaaccctg gccttaaaat tccaaaagaa gcatttgaac       300
     aacctcagac cagttccaca ccacctcgag atttagactc caaggcttgc atttctattg       360
     gaaatcagaa ctttgaggtg aaggcagatg acctggagcc tataatggaa ctgggacgag       420
     gtgcgtacgg ggtggtggag aagatgcggc acgtgcccag cgggcagatc atggcagtga       480
     agcggatccg agccacagta aatagccagg aacagaaacg gctactgatg gatttggata       540
     tttccatgag gacggtggac tgtccattca ctgtcacctt ttatggcgca ctgtttcggg       600
     agggtgatat gtggatctgc atggagctca tggatacatc actagataaa ttctacaaac       660
     aagttattga taaaggccag acaattccag aggacatctt agggaaaata gcagtttcta       720
     ttgtaaaagc attagaacat ttacatagta agctgtctgt cattcacaga gacgtcaagc       780
     cttctaatgt actcatcaat gctctcggtc aagtgaagat gtgcgatttt ggaatcagtg       840
     gctacttggt ggactctgtt gctaaaacaa ttgatgcagg ttgcaaacca tacatggccc       900
     ctgaaagaat aaacccagag ctcaaccaga agggatacag tgtgaagtct gacatttgga       960
     gtctgggcat cacgatgatt gagttggcca tccttcgatt tccctatgat tcatggggaa      1020
     ctccatttca gcagctcaaa caggtggtag aggagccatc gccacaactc ccagcagaca      1080
     agttctctgc agagtttgtt gactttacct cacagtgctt aaagaagaat tccaaagaac      1140
     ggcctacata cccagagcta atgcaacatc catttttcac cctacatgaa tccaaaggaa      1200
     cagatgtggc atcttttgta aaactgattc ttggagacta aaaagcagtg gacttaatcg      1260
     gttgacccta ctgtggattg gtgggtttcg gggtgaagca agttcactac agcatcaata      1320
     gaaagtcatc tttgagataa tttaaccctg cctctcagag ggttttctct cccaattttc      1380
     tttttactcc ccctcttaag ggggccttgg aatctatagt atagaatgaa ctgtctagat      1440
     ggatgaatta tgataaaggc ttaggacttc aaaaggtgat taaatattta atgatgtgtc      1500
     atatgagaaa aaaaaaaaa                                                   1519
//

If you have problems or comments...

PBIL Back to PBIL home page