(data stored in ACNUC8465 zone)

EMBL: U39065

ID   U39065; SV 1; linear; mRNA; STD; HUM; 1572 BP.
XX
AC   U39065;
XX
DT   02-MAR-1996 (Rel. 47, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Human MAP kinase kinase 6b mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1519
RX   DOI; 10.1074/jbc.271.6.2886.
RX   PUBMED; 8621675.
RA   Han J., Lee J.D., Jiang Y., Li Z., Feng L., Ulevitch R.J.;
RT   "Characterization of the structure and function of a novel MAP kinase
RT   kinase (MKK6)";
RL   J Biol Chem 271(6):2886-2891(1996).
XX
RN   [2]
RP   1-1572
RA   Han J.;
RT   ;
RL   Submitted (23-OCT-1995) to the INSDC.
RL   Jiahuai Han, Immunology, The Scripps Research Institute, 10666 N. Torrey
RL   Pines Rd., La Jolla, CA 92037, USA
XX
DR   MD5; d07354952480d0af2818785d71facf11.
DR   Ensembl-Gn; ENSG00000108984; homo_sapiens.
DR   Ensembl-Tr; ENST00000589647; homo_sapiens.
DR   Ensembl-Tr; ENST00000590474; homo_sapiens.
DR   Ensembl-Tr; ENST00000613873; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1572
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        286..1290
FT                   /codon_start=1
FT                   /product="MAP kinase kinase 6b"
FT                   /note="protein kinase"
FT                   /db_xref="GOA:P52564"
FT                   /db_xref="H-InvDB:HIT000219621.14"
FT                   /db_xref="HGNC:HGNC:6846"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:2Y8O"
FT                   /db_xref="PDB:3ENM"
FT                   /db_xref="PDB:3FME"
FT                   /db_xref="PDB:3VN9"
FT                   /db_xref="PDB:5ETF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52564"
FT                   /protein_id="AAB03705.1"
FT                   /translation="MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQN
FT                   FEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISM
FT                   RTVDCPFTVTFYGALFREGDMWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIV
FT                   KALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAP
FT                   ERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD
FT                   KFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD"
XX
SQ   Sequence 1572 BP; 468 A; 337 C; 364 G; 403 T; 0 other;
     ttggcacgag gagcttttag ctgccagccc tggcccatca tgtagctgca gcacagcctt        60
     ccctaacgtt gcaactgggg gaaaaatcac tttccagtct gttttgcaag gtgtgcattt       120
     ccatcttgat tccctgaaag tccatctgct gcatcggtca agagaaactc cacttgcatg       180
     aagattgcac gcctgcagct tgcatctttg ttgcaaaact agctacagaa gagaagcaag       240
     gcaaagtctt ttgtgctccc ctcccccatc aaaggaaagg ggaaaatgtc tcagtcgaaa       300
     ggcaagaagc gaaaccctgg ccttaaaatt ccaaaagaag catttgaaca acctcagacc       360
     agttccacac cacctcgaga tttagactcc aaggcttgca tttctattgg aaatcagaac       420
     tttgaggtga aggcagatga cctggagcct ataatggaac tgggacgagg tgcgtacggg       480
     gtggtggaga agatgcggca cgtgcccagc gggcagatca tggcagtgaa gcggatccga       540
     gccacagtaa atagccagga acagaaacgg ctactgatgg atttggatat ttccatgagg       600
     acggtggact gtccattcac tgtcaccttt tatggcgcac tgtttcggga gggtgatatg       660
     tggatctgca tggagctcat ggatacatca ctagataaat tctacaaaca agttattgat       720
     aaaggccaga caattccaga ggacatctta gggaaaatag cagtttctat tgtaaaagca       780
     ttagaacatt tacatagtaa gctgtctgtc attcacagag acgtcaagcc ttctaatgta       840
     ctcatcaatg ctctcggtca agtgaagatg tgcgattttg gaatcagtgg ctacttggtg       900
     gactctgttg ctaaaacaat tgatgcaggt tgcaaaccat acatggcccc tgaaagaata       960
     aacccagagc tcaaccagaa gggatacagt gtgaagtctg acatttggag tctgggcatc      1020
     acgatgattg agttggccat ccttcgattt ccctatgatt catggggaac tccatttcag      1080
     cagctcaaac aggtggtaga ggagccatcg ccacaactcc cagcagacaa gttctctgca      1140
     gagtttgttg actttacctc acagtgctta aagaagaatt ccaaagaacg gcctacatac      1200
     ccagagctaa tgcaacatcc atttttcacc ctacatgaat ccaaaggaac agatgtggca      1260
     tcttttgtaa aactgattct tggagactaa aaagcagtgg acttaatcgg ttgaccctac      1320
     tgtggattgg tgggtttcgg ggtgaagcaa gttcactaca gcatcaatag aaagtcatct      1380
     ttgagataat ttaaccctgc ctctcagagg gttttctctc ccaattttct ttttactccc      1440
     cctcttaagg gggccttgga atctatagta tagaatgaac tgtctagatg gatgaattat      1500
     gataaaggct taggacttca aaaggtgatt aaatatttaa tgatgtgtca tatgaaaaaa      1560
     aaaaaaaaaa aa                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page