(data stored in ACNUC8465 zone)

EMBL: U39656

ID   U39656; SV 2; linear; mRNA; STD; HUM; 1646 BP.
XX
AC   U39656;
XX
DT   29-FEB-1996 (Rel. 47, Created)
DT   15-NOV-2016 (Rel. 131, Last updated, Version 4)
XX
DE   Homo sapiens MAP kinase kinase 6 (MKK6) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1646
RX   PUBMED; 8622669.
RA   Raingeaud J., Whitmarsh A.J., Barrett T., Derijard B., Davis R.J.;
RT   "MKK3- and MKK6-regulated gene expression is mediated by the p38
RT   mitogen-activated protein kinase signal transduction pathway";
RL   Mol. Cell. Biol. 16(3):1247-1255(1996).
XX
RN   [2]
RP   1-1646
RA   Raingeaud J., Barrett T., Davis R.J.;
RT   ;
RL   Submitted (27-OCT-1995) to the INSDC.
RL   Roger J. Davis, Molecular Medicine, HHMI and UMASS Medical School, 373
RL   Plantation Street, Worcester, MA 01605, USA
XX
DR   MD5; 3fdde7e0686d5087a694dadbbbb20ab0.
DR   Ensembl-Gn; ENSG00000108984; homo_sapiens.
DR   Ensembl-Tr; ENST00000589647; homo_sapiens.
DR   Ensembl-Tr; ENST00000590474; homo_sapiens.
DR   Ensembl-Tr; ENST00000613873; homo_sapiens.
DR   EuropePMC; PMC2678890; 18695677.
DR   EuropePMC; PMC84667; 10490613.
XX
CC   On Nov 14, 2016 this sequence version replaced gi:1203815.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1646
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="skeletal muscle"
FT                   /db_xref="taxon:9606"
FT   gene            1..1646
FT                   /gene="MKK6"
FT   CDS_pept        288..1292
FT                   /codon_start=1
FT                   /gene="MKK6"
FT                   /product="MAP kinase kinase 6"
FT                   /function="MAP kinase kinase 6 phosphorylates and activates
FT                   p38 MAP kinase"
FT                   /note="protein kinase"
FT                   /db_xref="GOA:P52564"
FT                   /db_xref="H-InvDB:HIT000219694.14"
FT                   /db_xref="HGNC:HGNC:6846"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:2Y8O"
FT                   /db_xref="PDB:3ENM"
FT                   /db_xref="PDB:3FME"
FT                   /db_xref="PDB:3VN9"
FT                   /db_xref="PDB:5ETF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52564"
FT                   /protein_id="AAC50388.1"
FT                   /translation="MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQN
FT                   FEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISM
FT                   RTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIV
FT                   KALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAP
FT                   ERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD
FT                   KFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD"
XX
SQ   Sequence 1646 BP; 534 A; 339 C; 365 G; 408 T; 0 other;
     gttccaagtt tggagctttt agctgccagc cctggcccat catgtagctg cagcacagcc        60
     ttccctaacg ttgcaactgg gggaaaaatc actttccagt ctgttttgca aggtgtgcat       120
     ttccatcttg attccctgaa agtccatctg ctgcatcggt caagagaaac tccacttgca       180
     tgaagattgc acgcctgcag cttgcatctt tgttgcaaaa ctagctacag aagagaagca       240
     aggcaaagtc ttttgtgctc ccctccccca tcaaaggaaa ggggaaaatg tctcagtcga       300
     aaggcaagaa gcgaaaccct ggccttaaaa ttccaaaaga agcatttgaa caacctcaga       360
     ccagttccac accacctaga gatttagact ccaaggcttg catttctatt ggaaatcaga       420
     actttgaggt gaaggcagat gacctggagc ctataatgga actgggacga ggtgcgtacg       480
     gggtggtgga gaagatgcgg cacgtgccca gcgggcagat catggcagtg aagcggatcc       540
     gagccacagt aaatagccag gaacagaaac ggctactgat ggatttggat atttccatga       600
     ggacggtgga ctgtccattc actgtcacct tttatggcgc actgtttcgg gagggtgatg       660
     tgtggatctg catggagctc atggatacat cactagataa attctacaaa caagttattg       720
     ataaaggcca gacaattcca gaggacatct tagggaaaat agcagtttct attgtaaaag       780
     cattagaaca tttacatagt aagctgtctg tcattcacag agacgtcaag ccttctaatg       840
     tactcatcaa tgctctcggt caagtgaaga tgtgcgattt tggaatcagt ggctacttgg       900
     tggactctgt tgctaaaaca attgatgcag gttgcaaacc atacatggcc cctgaaagaa       960
     taaacccaga gctcaaccag aagggataca gtgtgaagtc tgacatttgg agtctgggca      1020
     tcacgatgat tgagttggcc atccttcgat ttccctatga ttcatgggga actccatttc      1080
     agcagctcaa acaggtggta gaggagccat cgccacaact cccagcagac aagttctctg      1140
     cagagtttgt tgactttacc tcacagtgct taaagaagaa ttccaaagaa cggcctacat      1200
     acccagagct aatgcaacat ccatttttca ccctacatga atccaaagga acagatgtgg      1260
     catcttttgt aaaactgatt cttggagact aaaaagcagt ggacttaatc ggttgaccct      1320
     actgtggatt ggtgggtttc ggggtgaagc aagttcacta cagcatcaat agaaagtcat      1380
     ctttgagata atttaaccct gcctctcaga gggttttctc tcccaatttt ctttttactc      1440
     cccctcttaa gggggccttg gaatctatag tatagaatga actgtctaga tggatgaatt      1500
     atgataaagg cttaggactt caaaaggtga ttaaatattt aatgatgtgt catatgagtc      1560
     ctcaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1620
     aaaaaaaaaa aaaaaaaaaa aaaaaa                                           1646
//

If you have problems or comments...

PBIL Back to PBIL home page