(data stored in ACNUC8465 zone)

EMBL: U39657

ID   U39657; SV 2; linear; mRNA; STD; HUM; 2871 BP.
XX
AC   U39657;
XX
DT   29-FEB-1996 (Rel. 47, Created)
DT   15-NOV-2016 (Rel. 131, Last updated, Version 4)
XX
DE   Homo sapiens MAP kinase kinase 6 (MKK6) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2871
RX   PUBMED; 8622669.
RA   Raingeaud J., Whitmarsh A.J., Barrett T., Derijard B., Davis R.J.;
RT   "MKK3- and MKK6-regulated gene expression is mediated by the p38
RT   mitogen-activated protein kinase signal transduction pathway";
RL   Mol. Cell. Biol. 16(3):1247-1255(1996).
XX
RN   [2]
RP   1-2871
RA   Raingeaud J., Barrett T., Davis R.J.;
RT   ;
RL   Submitted (27-OCT-1995) to the INSDC.
RL   Roger J. Davis, Molecular Medicine, HHMI and UMASS Medical School, 373
RL   Plantation Street, Worcester, MA 01605, USA
XX
DR   MD5; 24daaa57aa6822de9f2dd4a681b9fe5e.
DR   Ensembl-Gn; ENSG00000108984; homo_sapiens.
DR   Ensembl-Tr; ENST00000589647; homo_sapiens.
DR   Ensembl-Tr; ENST00000590474; homo_sapiens.
DR   Ensembl-Tr; ENST00000613873; homo_sapiens.
DR   EuropePMC; PMC2173571; 11781339.
DR   EuropePMC; PMC2394425; 14583782.
XX
CC   On Nov 14, 2016 this sequence version replaced gi:1203817.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2871
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="skeletal muscle"
FT                   /db_xref="taxon:9606"
FT   gene            1..2871
FT                   /gene="MKK6"
FT   CDS_pept        288..1292
FT                   /codon_start=1
FT                   /gene="MKK6"
FT                   /product="MAP kinase kinase 6"
FT                   /function="MAP kinase kinase 6 phosphorylates and activates
FT                   p38 MAP kinase"
FT                   /note="protein kinase"
FT                   /db_xref="GOA:P52564"
FT                   /db_xref="H-InvDB:HIT000219695.15"
FT                   /db_xref="HGNC:HGNC:6846"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:2Y8O"
FT                   /db_xref="PDB:3ENM"
FT                   /db_xref="PDB:3FME"
FT                   /db_xref="PDB:3VN9"
FT                   /db_xref="PDB:5ETF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52564"
FT                   /protein_id="AAC50389.1"
FT                   /translation="MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQN
FT                   FEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISM
FT                   RTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIV
FT                   KALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAP
FT                   ERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD
FT                   KFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD"
XX
SQ   Sequence 2871 BP; 831 A; 545 C; 641 G; 854 T; 0 other;
     gttccaagtt tggagctttt agctgccagc cctggcccat catgtagctg cagcacagcc        60
     ttccctaacg ttgcaactgg gggaaaaatc actttccagt ctgttttgca aggtgtgcat       120
     ttccatcttg attccctgaa agtccatctg ctgcatcggt caagagaaac tccacttgca       180
     tgaagattgc acgcctgcag cttgcatctt tgttgcaaaa ctagctacag aagagaagca       240
     aggcaaagtc ttttgtgctc ccctccccca tcaaaggaaa ggggaaaatg tctcagtcga       300
     aaggcaagaa gcgaaaccct ggccttaaaa ttccaaaaga agcatttgaa caacctcaga       360
     ccagttccac accacctaga gatttagact ccaaggcttg catttctatt ggaaatcaga       420
     actttgaggt gaaggcagat gacctggagc ctataatgga actgggacga ggtgcgtacg       480
     gggtggtgga gaagatgcgg cacgtgccca gcgggcagat catggcagtg aagcggatcc       540
     gagccacagt aaatagccag gaacagaaac ggctactgat ggatttggat atttccatga       600
     ggacggtgga ctgtccattc actgtcacct tttatggcgc actgtttcgg gagggtgatg       660
     tgtggatctg catggagctc atggatacat cactagataa attctacaaa caagttattg       720
     ataaaggcca gacaattcca gaggacatct tagggaaaat agcagtttct attgtaaaag       780
     cattagaaca tttacatagt aagctgtctg tcattcacag agacgtcaag ccttctaatg       840
     tactcatcaa tgctctcggt caagtgaaga tgtgcgattt tggaatcagt ggctacttgg       900
     tggactctgt tgctaaaaca attgatgcag gttgcaaacc atacatggcc cctgaaagaa       960
     taaacccaga gctcaaccag aagggataca gtgtgaagtc tgacatttgg agtctgggca      1020
     tcacgatgat tgagttggcc atccttcgat ttccctatga ttcatgggga actccatttc      1080
     agcagctcaa acaggtggta gaggagccat cgccacaact cccagcagac aagttctctg      1140
     cagagtttgt tgactttacc tcacagtgct taaagaagaa ttccaaagaa cggcctacat      1200
     acccagagct aatgcaacat ccatttttca ccctacatga atccaaagga acagatgtgg      1260
     catcttttgt aaaactgatt cttggagact aaaaagcagt ggacttaatc ggttgaccct      1320
     actgtggatt ggtgggtttc ggggtgaagc aagttcacta cagcatcaat agaaagtcat      1380
     ctttgagata atttaaccct gcctctcaga gggttttctc tcccaatttt ctttttactc      1440
     cccctcttaa gggggccttg gaatctatag tatagaatga actgtctaga tggatgaatt      1500
     atgataaagg cttaggactt caaaaggtga ttaaatattt aatgatgtgt catatgagtc      1560
     ctcaagcttc tcagacttct cttattcttt acaaaatgaa tgcattggcc ctgacaaaaa      1620
     ggtgctacgg tagtgatgaa attataagta gatttgtagt ttgtcccatt tattatttta      1680
     atatttatgt ttaagtgctt ggttgaaaag attccatttt atacaagaag ggagattcaa      1740
     aaaaaaaata taaggttggg ttagcaatat ttatagggct tttatttttt aagttcaatt      1800
     gtgtctgtgg tccagaagaa attatttaat atgcatcttt gagaatatta taaaaatatc      1860
     aaaaaggagc tcttcttgtg aaatgtctgt tccagctgtt gtgactgctg ccatttttgg      1920
     aaacatctgc ccaatcctgg gtgatcacca catcttttag gggaagtgac aagatgctct      1980
     ggtcatactc tttttcccaa ctttggaaaa cataaaaatc actcatataa cagctcaaag      2040
     agtaaaacat ttggttcttc tgacacttgt ggtatagtat tagtggaaag tgatttgtaa      2100
     tatgatttta tatccaccta cctattcatc tacctgtgtg tatgtgtgtg tttgtgtgtc      2160
     tatttggcaa ttcacaagtc ctgccaagtg gtttctatga gcatctctgt ttggtaagga      2220
     ggacaattgt cagttttgag ggggacatgt gttaaatcac agaaaaaaat ggtgccttct      2280
     tctgcgtttg tccctcctgc catgtgtaag ttgtaaggat tgcctttgta gttaatgtac      2340
     tctttggctt tgtttgtttg ttttcttctt cagtgaagca gccttactat tcatagaagg      2400
     gctagaatag gagaaaatga aaggtagtga gtaattcttt gataagatga ggaaataatg      2460
     ggaaaggttg aattaattcc tgggcatgga ctaccagatg accacaagtt gcgttgaggc      2520
     cgcatctttc ttcagcagcg tgcaatagct ggctcctcta taggagatga gcttcattgg      2580
     gagttcctag caagttgact aaacagcaaa agttctttct cgtgggtaaa tatacccaca      2640
     ggttctatga tttgtagctc taggtttctt gatgatcaag gagtgaagta attgacaggg      2700
     aaaatataga cctatgataa ataaccagga agcattgctt ttggacaagg aagaacagag      2760
     ggttttgatt ttaaaaagaa gaaaaaaaaa ccttattttt tctttcttgg cctcaagttc      2820
     aatatggaga ggattgcttc cctgaatcct ctcttccttc cccttttaga g               2871
//

If you have problems or comments...

PBIL Back to PBIL home page