(data stored in ACNUC8465 zone)

EMBL: U40848

ID   U40848; SV 1; linear; mRNA; STD; VRT; 2148 BP.
XX
AC   U40848;
XX
DT   23-DEC-1995 (Rel. 46, Created)
DT   27-JUN-2018 (Rel. 137, Last updated, Version 5)
XX
DE   Gallus gallus cell division cycle protein (CDC42) mRNA, complete cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-2148
RX   DOI; 10.1016/0378-5955(96)00013-5.
RX   PUBMED; 8817303.
RA   Gong T.W., Hegeman A.D., Shin J.J., Adler H.J., Raphael Y., Lomax M.I.;
RT   "Identification of genes expressed after noise exposure in the chick
RT   basilar papilla";
RL   Hear. Res. 96(1-2):20-32(1996).
XX
RN   [2]
RP   1-2148
RX   DOI; 10.1016/S0167-4781(97)00027-4.
RX   PUBMED; 9224952.
RA   Gong T.W., Shin J.J., Burmeister M., Lomax M.I.;
RT   "Complete cDNAs for CDC42 from chicken cochlea and mouse liver";
RL   Biochim. Biophys. Acta 1352(3):282-292(1997).
XX
RN   [3]
RP   1-2148
RA   Lomax M.I., Gong T.L., Shin J.J.;
RT   ;
RL   Submitted (17-NOV-1995) to the INSDC.
RL   Margaret I. Lomax, Otolaryngology, University of Michigan, 9301E MSRB3, Ann
RL   Arbor, MI 48109-0648, USA
XX
DR   MD5; a756cc2b8d289ce5d4b31c1172eb8cf0.
DR   Ensembl-Gn; ENSGALG00000004796; gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000034897; gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000049495; gallus_gallus.
DR   EuropePMC; PMC29714; 11222756.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2148
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="inner ear"
FT                   /db_xref="taxon:9031"
FT   gene            1..2148
FT                   /gene="CDC42"
FT   5'UTR           1..238
FT                   /gene="CDC42"
FT   CDS_pept        239..814
FT                   /codon_start=1
FT                   /gene="CDC42"
FT                   /product="CDC42"
FT                   /function="GTP-binding protein"
FT                   /note="G25K cell division cycle protein"
FT                   /db_xref="GOA:Q90694"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037874"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q90694"
FT                   /protein_id="AAC00027.1"
FT                   /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
FT                   IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHH
FT                   CPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQK
FT                   GLKNVFDEAILAALEPPEPKKTRRCVLL"
FT   3'UTR           815..2148
FT                   /gene="CDC42"
FT   regulatory      2108..2113
FT                   /gene="CDC42"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2127
FT                   /gene="CDC42"
XX
SQ   Sequence 2148 BP; 559 A; 462 C; 492 G; 635 T; 0 other;
     cggcacgagc gggagcgctg tgcgggttgc actccgcctc ggcaccgtgc tcccacggcg        60
     cagtgggaag ggcggagggg taggcgagcc gggcccggag ccggccgtgt gggtgccgcg       120
     ctccctgggg ctgcggtgtg tgtttgtgtg tggggcctct ccaccgctgg gccggggctg       180
     ttggcgcaga gcggggctga ggttcacgtt ggagttgata ctgtagcaga cttcagctat       240
     gcagacgatt aagtgtgtag ttgtgggtga tggtgctgtt ggtaaaacct gtctcttaat       300
     ttcttacaca acaaataaat ttccatcgga atacgtacca acggtttttg ataactatgc       360
     tgtaacagtg atgattggag gagagcctta cactctaggc ctctttgata ctgcaggtca       420
     ggaagattat gatagattac gacccctcag ctatccacag acagatgtat ttctggtctg       480
     tttttcagtg gtatctcctt cttcatttga aaatgtgaaa gaaaagtggg tacctgaaat       540
     tactcaccat tgtccaaaga ctccttttct gcttgttggg acccaaattg atctaagaga       600
     tgatccctca acaattgaaa aacttgccaa gaacaagcag aagcccataa ctccagagac       660
     ggctgaaaaa ctggcccggg acctgaaggc tgttaaatat gtggaatgct ctgcgcttac       720
     gcagaaaggc ctaaagaatg tatttgatga ggcgatattg gctgccctgg agcctccgga       780
     gccgaagaag actcgcaggt gtgtgctgct atgaacgtcc ctccacagcc ccttctgcaa       840
     agctggtgtt tgatgtcata ctaaaagcaa tgtttaaatc aaactaaaga tacaaatttt       900
     aaaatttgtt ttttgcaata atgacaaata ccctgcactc ccatctcccc cacacgatcc       960
     ctgtgtgaga tgagaatgtt agtgtttatt ccccagtgtc tcctcaattc agttaaacta      1020
     gttaattttg cgtaattacg tagtatcaga aaacactgat cagtactagt tttttatttt      1080
     gtttactgtt tctaattttt tgtttaaaat ccaggcatgc ttgtcatgac tttttctgta      1140
     acagactaat tctgggctat attgaagcct tgccccttct gccagtctgg caagacttag      1200
     ttctggtttc aagaactcct agggctgttc tgcagccagc cagcagccta tgtgtgagca      1260
     gcctttcata ctaaagacaa atacaggaaa gtaagatgtc ccaggctggt gctcctctaa      1320
     ggaggagtgt agaaaatgta tctgcatctc ctctgaagtt gccttgtatc tctctccccc      1380
     tggcttccca ctgtacaagt cataaatttc tgccccatcc tttaagttat aaagttttat      1440
     gaatggaaga atcctttccc ctggatgcac catcagactt ggaaactaac ttgtcagtct      1500
     cttaatgagc ttttggtcat gtgatgaaga aataactgca ccttttaaag tgtgcccaac      1560
     tgattcagtt ggcttttaaa caagcgcatc tttctgccaa ttctttctta tctgagaaat      1620
     acttccaatg accagcatat tcactgctgt ttggatgcac tgtaaagaac ttggcatgta      1680
     ttggaatgag tagctgcccc tggtggtgca tctccctatg aaggtttggt gtcctttgag      1740
     gagaggttga aagacagacc tgtcagtagg aaggaactgc ggggagggct tcctagtgtt      1800
     cagcatggca ccatacaggg accagttgag ggaatcccct tttctgcatt ttaagtaacc      1860
     ttgaaactgt aagatgggtt ccagcccaac aaggattgtg tgcaggacct ttacgtagac      1920
     agcagtattt gtagggactt taccaaataa catattttgg cttgcaagtt aaattgtttt      1980
     tcttttaggg aaaagattta gggaatcttc tccatcttcc caagctccaa tttcttgtca      2040
     actcattagt gttgaaccaa tgctttttca tgtctaagtt ctttgtatat gcattctttt      2100
     cagatgtatt aaacataaaa tatcttcaca aaaaaaaaaa aaaaaaaa                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page