(data stored in SCRATCH zone)

EMBL: U43929

ID   U43929; SV 1; linear; genomic DNA; STD; PRO; 4620 BP.
XX
AC   U43929;
XX
DT   27-JAN-1996 (Rel. 46, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Bacillus subtilis ribosomal protein gene cluster, rpsJ, rplC, rplD, rplW,
DE   rplB, rpsS, rplV and rpsC genes, complete cds, and rplP gene, partial cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-4620
RX   PUBMED; 9371452.
RA   Li X., Lindahl L., Sha Y., Zengel J.M.;
RT   "Analysis of the Bacillus subtilis S10 ribosomal protein gene cluster
RT   identifies two promoters that may be responsible for transcription of the
RT   entire 15-kilobase S10-spc-alpha cluster";
RL   J. Bacteriol. 179(22):7046-7054(1997).
XX
RN   [2]
RP   1-4620
RA   Li X., Lindahl L., Zengel J.M.;
RT   ;
RL   Submitted (22-DEC-1995) to the INSDC.
RL   Janice M. Zengel, Biol. Sci., UMBC, 5401 Wilkens Ave., Baltimore, MD 21228,
RL   USA
XX
DR   MD5; 231afda087d5aa78b709bf3c8aa2fe5b.
DR   EuropePMC; PMC90215; 11083650.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4620
FT                   /organism="Bacillus subtilis"
FT                   /map="12 degrees"
FT                   /strain="SG38"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        319..627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /product="S10"
FT                   /note="ribosomal protein"
FT                   /db_xref="GOA:P21471"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21471"
FT                   /protein_id="AAC45955.1"
FT                   /translation="MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTE
FT                   KSVYTILLAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL"
FT   CDS_pept        667..1296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /product="L3"
FT                   /note="ribosomal protein"
FT                   /db_xref="GOA:P42920"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42920"
FT                   /protein_id="AAC45956.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTAENDG
FT                   YEAIQLGFDDKREKLSNKPEKGHVAKAETAPKRFVKELRGVEMDAYEVGQEVKVEIFSA
FT                   GEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGR
FT                   MGGEQITVQNLEIVKVDAERNLLLIKGNVPGAKKSLITVKSAVKSK"
FT   CDS_pept        1324..1947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /product="L4"
FT                   /note="ribosomal protein"
FT                   /db_xref="GOA:P42921"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42921"
FT                   /protein_id="AAC45957.1"
FT                   /translation="MPKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLR
FT                   QGTHKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKK
FT                   VRRLAIKSVLSSKVIDNNIIVLEDLTLDTAKTKEMAAILKGLSVEKKALIVTADANEAV
FT                   ALSARNIPGVTVVEANGINVLDVVNHEKLLITKAAVEKVEEVLA"
FT   CDS_pept        1947..2234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /product="L23"
FT                   /note="ribosomal protein"
FT                   /db_xref="GOA:P42924"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42924"
FT                   /protein_id="AAC45958.1"
FT                   /translation="MKDPRDVLKRPVITERSADLMTEEKYTFEVDVRANKTEAKDAVES
FT                   IFGVKVDKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA"
FT   CDS_pept        2266..3099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /product="L2"
FT                   /note="ribosomal protein"
FT                   /db_xref="GOA:P42919"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42919"
FT                   /protein_id="AAC45959.1"
FT                   /translation="MAIKKYKPSSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNN
FT                   QGKLTVRHQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEKRYI
FT                   LAPKGIQVGTEVMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQHELINIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK"
FT   CDS_pept        3157..3435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /product="S19"
FT                   /note="ribosomal protein"
FT                   /db_xref="GOA:P21476"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21476"
FT                   /protein_id="AAC45960.1"
FT                   /translation="MARSLKKGPFVDGHLMTKIEKLNETDKKQVVKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVFISEDMVGHKLGEFAPTRTYKGHASDDKKTRR"
FT   CDS_pept        3452..3793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /product="L22"
FT                   /note="ribosomal protein"
FT                   /db_xref="GOA:P42060"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42060"
FT                   /protein_id="AAC45961.1"
FT                   /translation="MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASP
FT                   IIEKVLKSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHIT
FT                   IVVSEKKEG"
FT   CDS_pept        3797..4453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /product="S3"
FT                   /note="ribosomal protein"
FT                   /db_xref="GOA:P21465"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21465"
FT                   /protein_id="AAC45962.1"
FT                   /translation="MGQKVNPVGLRIGVIRDWESKWYAGKDYADFLHEDLKIREYISKR
FT                   LSDASVSKVEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILE
FT                   IKRADLDAQLVADNIARQLENRVSFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIAR
FT                   SEYYSEGTVPLHTLRADIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKNEEGGK"
FT   CDS_pept        4455..>4620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /product="L16"
FT                   /note="ribosomal protein"
FT                   /db_xref="GOA:P14577"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14577"
FT                   /protein_id="AAC45963.1"
FT                   /translation="MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGIQALEASWITNR
FT                   QIEAARIAMT"
XX
SQ   Sequence 4620 BP; 1477 A; 932 C; 1035 G; 1176 T; 0 other;
     gaattcagct cacaccccgc atattgagga gccatcatta ttcgcgaaca cattaagtcg        60
     gcatgcacga caccatttat gatagatcct tgataaataa gaaaaacccc tgtataataa       120
     aaaaagtgtg caaatcatgc atattttaaa taagtcttgc aacatgcgcc tattttctgt       180
     ataatggtgt atgttggtct ttgactgcga tgaagtgaga ggttgctgac acacccggcc       240
     gctttgccat ggcaaggtgt tcaggttttt ctcacggaga actgtctaac gtgatgtagg       300
     cgaaaaggag ggaaaataat ggcaaaacaa aaaattcgta ttcgtttgaa agcatatgat       360
     catagaatcc ttgatcaatc tgcagagaag attgttgaaa cggcaaaacg ttctggtgcc       420
     agcgtatctg gtccgattcc gttgccaact gaaaaatcag tttacacaat ccttctggcg       480
     gtgcacaaat acaaagattc tcgtgagcaa tttgaaatgc gtacacataa acgtttaatc       540
     gacattgtga acccaacacc acaaactgtt gatgctctta tgcgattaga cttaccatct       600
     ggtgtcgata tcgaaattaa actttaattc taaaatatag aatgatctta ataggaggtg       660
     tgacgaatga ccaaaggaat cttaggaaga aaaattggta tgacgcaagt attcgctgag       720
     aatggtgatc ttattccggt aactgttatc gaggctgctc caaacgttgt tcttcaaaag       780
     aaaacagctg aaaacgacgg ttacgaagca atccagcttg gttttgacga caagcgtgaa       840
     aagctttcta acaaacctga aaaagggcac gttgcaaaag cggaaactgc tcctaagcgc       900
     ttcgttaaag aattacgcgg agtggaaatg gatgcgtatg aagttggtca ggaagtcaag       960
     gttgaaattt tctctgctgg agaaatcgta gatgtaacag gagtatctaa aggtaaaggt      1020
     ttccaaggtg cgatcaagcg ccacggacaa tctcgcggac ctatgtctca cggttcacgc      1080
     taccaccgtc gtcctggttc aatgggacct gtagatccta accgtgtatt caaaggtaaa      1140
     ttattacctg gacgtatggg cggagagcaa atcactgttc aaaaccttga aatcgtaaaa      1200
     gttgatgcag aacgcaatct tcttttgatc aaaggtaacg tacctggtgc gaagaaatct      1260
     ttaatcactg ttaaaagtgc tgttaaatct aaataattct cttaggaaag gaggaaattg      1320
     attatgccaa aagtagcatt atacaaccaa aacggttcta ctgctggtga catcgaatta      1380
     aacgcttctg tatttggtat cgaaccaaat gagagtgttg tattcgacgc tattcttatg      1440
     caaagagctt ccttacgtca aggaactcac aaagtaaaaa atcgttctga agtacgcggc      1500
     ggaggtcgta aaccatggcg tcaaaaaggt actggacgtg cccgtcaagg ttcaatccgt      1560
     tcaccgcaat ggcgcggagg tggtgtcgta ttcggcccaa caccacgcag ctattcttat      1620
     aaattaccta aaaaagttcg ccgcttggca atcaaatcag tattgtcttc taaagtgatc      1680
     gacaacaaca tcatcgttct tgaagatctt actcttgata cggctaaaac aaaagaaatg      1740
     gcagctatcc ttaaaggatt atctgttgag aaaaaagctt taatcgtaac tgcggatgca      1800
     aacgaagcag tagcattatc tgctcgtaac attcctggag ttactgttgt tgaagctaac      1860
     ggaatcaacg ttttagacgt tgtcaaccac gagaagcttc tgattacaaa agcagcggtt      1920
     gaaaaagtag aggaggtgct tgcataatga aagatcctcg tgatgttcta aagcgccccg      1980
     tcattactga acgttctgcc gatttaatga ctgaagaaaa atatactttt gaagttgatg      2040
     taagagctaa caaaacagaa gcgaaagacg cggttgaaag catctttgga gtgaaagttg      2100
     acaaagtcaa catcatgaac tacaaaggca aatcaaaacg tgttggacgc tacactggta      2160
     tgactagccg tcgcagaaaa gcgatcgtaa aacttactgc agacagcaaa gaaatcgaaa      2220
     tttttgaagc ttaattatct gtaaaaagaa ggagggaaat tcaaaatggc gattaaaaag      2280
     tataaaccgt cctctaatgg acgtcgtggc atgacaactt cagattttgc tgaaatcacg      2340
     actgacaagc cggaaaaatc cttgcttgct ccccttcaca aaaaaggcgg acgtaacaac      2400
     caaggtaaat tgacggtacg tcaccaaggt ggcggacata aacgccaata ccgtgttatc      2460
     gacttcaaac gcgataaaga tggtatacct ggacgcgttg ctacagttga atacgatcca      2520
     aaccgttcag ctaacatcgc tctaatcaac tatgcagacg gagaaaaacg ttacattctt      2580
     gctcctaaag gaattcaagt aggtactgaa gtcatgtcag gtcctgaagc tgacattaaa      2640
     gtaggtaatg cacttccact tatcaacatc cctgttggta cagttgtgca taacattgaa      2700
     ttaaaacctg gtaaaggcgg acagcttgta cgttcagctg gtacatctgc tcaggttctt      2760
     ggtaaagaag gtaaatacgt tcttgtacgt cttaactctg gtgaagttcg catgatcctt      2820
     tctgcttgcc gtgcttctat cggtcaagta ggtaacgaac agcacgaact tatcaacatt      2880
     ggtaaagctg gacgttctcg ctggaaaggc atccgtccta cagttcgtgg ttctgtaatg      2940
     aaccctaacg atcacccaca cggtggtggt gaaggacgtg cgccaatcgg acgtaaatca      3000
     ccaatgtctc catggggcaa accaactctt ggattcaaga ctcgtaagaa aaagaacaaa      3060
     tccgataaat ttatcgtacg tcgtcgtaaa aataaataac ggggttgtct acggttcttt      3120
     tcggaccgta gtgcaatcac gaagggaggt tccaaaatgg ctcgcagctt aaaaaaagga      3180
     ccatttgtcg atggacactt gatgactaaa atcgagaaat taaatgaaac agacaagaaa      3240
     caagtcgtaa aaacttggtc tcgtcgttct actattttcc cacagtttat tggtcacaca      3300
     atcgcagtct atgacggacg taaacacgtg cctgtattca tctctgaaga tatggtaggg      3360
     cacaagttgg gtgaattcgc accaactcgt acgtacaaag gtcatgctag tgatgacaaa      3420
     aaaacaagac gctaagagag gaggctttta aatgcaagct aaagctgttg caagaacagt      3480
     ccgtattgct cctcgtaaag cacgtctagt aatggacctg attcgaggca agcaagtagg      3540
     tgaggcagta tcaatcttga accttacacc aagagctgct tctccaatta tcgagaaagt      3600
     attaaaatcc gctattgcaa atgctgagca taactatgaa atggacgcta acaacctggt      3660
     tatttctcaa gcattcgttg acgaaggccc tacgttaaaa agattccgcc cacgtgctat      3720
     gggacgtgcg agccaaatca acaaacgtac gagccacatt acaatcgttg tatcagaaaa      3780
     gaaggaggga taagtagtgg gtcaaaaggt aaatccagtc ggtcttcgta tcggagtcat      3840
     tcgtgattgg gaatctaagt ggtacgctgg aaaagattac gctgacttcc tgcacgaaga      3900
     tttaaaaatt cgtgaataca ttagcaaacg cctttctgac gcttctgttt ctaaagtaga      3960
     aattgagcgt gcagcaaacc gcgttaacat tacgatccac acagctaagc ctggtatggt      4020
     tatcggtaaa ggcggttctg aagtcgaagc acttcgcaaa gcccttaaca gccttactgg      4080
     caagcgtgta cacattaaca ttcttgaaat caaaagagca gatcttgatg cacagctagt      4140
     tgctgacaac atcgctcgtc aattggaaaa ccgtgtttct ttccgccgtg cgcagaaaca      4200
     acaaatccaa cgtactatgc gtgctggagc acaaggtgtg aaaacaatgg tttctggtcg      4260
     tcttggcggt gcagatatcg ctcgttctga atactacagt gaaggaactg ttccattgca      4320
     cacattacgt gcggacattg actatgcaac atctgaagct gatactactt acggtaagct      4380
     tggtgtaaaa gtctggatct atcgtggaga ggttcttcct actaagaaga aaaatgagga      4440
     aggaggaaaa taatatgtta ttaccaaaac gcgttaaata tcgcagagag catcgcggaa      4500
     aaatgcgtgg ccgtgcgaaa ggcggtactg aagtacattt cggagaattc ggtatccaag      4560
     ctctagaagc ttcttggatt actaaccgtc aaatcgaagc tgcacgtatt gcgatgactc      4620
//

If you have problems or comments...

PBIL Back to PBIL home page