(data stored in ACNUC8465 zone)

EMBL: U49732

ID   U49732; SV 2; linear; mRNA; STD; HUM; 1528 BP.
XX
AC   U49732;
XX
DT   17-MAY-1996 (Rel. 47, Created)
DT   20-NOV-2016 (Rel. 131, Last updated, Version 6)
XX
DE   Homo sapiens MAP kinase kinase MEK6 (MEK6) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1528
RX   DOI; 10.1074/jbc.271.19.11427.
RX   PUBMED; 8626699.
RA   Stein B., Brady H., Yang M.X., Young D.B., Barbosa M.S.;
RT   "Cloning and characterization of MEK6, a novel member of the
RT   mitogen-activated protein kinase kinase cascade";
RL   J Biol Chem 271(19):11427-11433(1996).
XX
RN   [2]
RP   1-1528
RA   Stein B.;
RT   ;
RL   Submitted (21-FEB-1996) to the INSDC.
RL   Bernd Stein, Signal Pharmaceuticals, 5555 Oberlin Drive, San Diego, CA
RL   92121, USA
XX
RN   [3]
RC   Sequence update by database staff to remove vector contamination
RP   1-1528
RA   Stein B.;
RT   ;
RL   Submitted (17-NOV-2016) to the INSDC.
RL   Bernd Stein, Signal Pharmaceuticals, 5555 Oberlin Drive, San Diego, CA
RL   92121, USA
XX
DR   MD5; 47e35af094127c4bb64a3fc961e80ffe.
DR   Ensembl-Gn; ENSG00000108984; homo_sapiens.
DR   Ensembl-Tr; ENST00000589647; homo_sapiens.
DR   Ensembl-Tr; ENST00000590474; homo_sapiens.
DR   Ensembl-Tr; ENST00000613873; homo_sapiens.
XX
CC   On Nov 17, 2016 this sequence version replaced gi:1314476.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1528
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1528
FT                   /gene="MEK6"
FT   CDS_pept        219..1223
FT                   /codon_start=1
FT                   /gene="MEK6"
FT                   /product="MAP kinase kinase MEK6"
FT                   /db_xref="GOA:P52564"
FT                   /db_xref="H-InvDB:HIT000220118.14"
FT                   /db_xref="HGNC:HGNC:6846"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:2Y8O"
FT                   /db_xref="PDB:3ENM"
FT                   /db_xref="PDB:3FME"
FT                   /db_xref="PDB:3VN9"
FT                   /db_xref="PDB:5ETF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52564"
FT                   /protein_id="AAB05035.1"
FT                   /translation="MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQN
FT                   FEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISM
FT                   RTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIV
FT                   KALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAP
FT                   ERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD
FT                   KFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD"
XX
SQ   Sequence 1528 BP; 469 A; 316 C; 350 G; 393 T; 0 other;
     gttgtaactg ggggaaaaat cactttccag tctgttttgc aaggtgtgca tttccatctt        60
     gattccctga aagtccatct gctgaatcgg tcaagagaaa ctccacttgc atgaagattg       120
     cacgcctgca gcttgcatct ttgttgcaaa actagctaca gaagagaagc aaggcaaagt       180
     cttttgtgct cccctccccc atcaaaggaa aggggaaaat gtctcagtcg aaaggcaaga       240
     agcgaaaccc tggccttaaa attccaaaag aagcatttga acaacctcag accagttcca       300
     caccacctcg agatttagac tccaaggctt gcatttctat tggaaatcag aactttgagg       360
     tgaaggcaga tgacctggag cctataatgg aactgggacg aggtgcgtac ggggtggtgg       420
     agaagatgcg gcacgtgccc agcgggcaga tcatggcagt gaagcggatc cgagccacag       480
     taaatagcca ggaacagaaa cggctactga tggatttgga tatttccatg aggacggtgg       540
     actgtccatt cactgtcacc ttttatggcg cactgtttcg ggagggtgat gtgtggatct       600
     gcatggagct catggataca tcactagata aattctacaa acaagttatt gataaaggcc       660
     agacaattcc agaggacatc ttagggaaaa tagcagtttc tattgtaaaa gcattagaac       720
     atttacatag taagctgtct gtcattcaca gagacgtcaa gccttctaat gtactcatca       780
     atgctctcgg tcaagtgaag atgtgcgatt ttggaatcag tggctacttg gtggactctg       840
     ttgctaaaac aattgatgca ggttgcaaac catacatggc ccctgaaaga ataaacccag       900
     agctcaacca gaagggatac agtgtgaagt ctgacatttg gagtctgggc atcacgatga       960
     ttgagttggc catccttcga tttccctatg attcatgggg aactccattt cagcagctca      1020
     aacaggtggt agaggagcca tcgccacaac tcccagcaga caagttctct gcagagtttg      1080
     ttgactttac ctcacagtgc ttaaagaaga attccaaaga acggcctaca tacccagagc      1140
     taatgcaaca tccatttttc accctacatg aatccaaagg aacagatgtg gcatcttttg      1200
     taaaactgat tcttggagac taaaaagcag tggacttaat cggttgaccc tacttgtgga      1260
     ttggtgggtt tcggggtgaa gcaagttcac tacagcatca atagaaagtc atctttgaga      1320
     taatttaacc ctgcctctca gagggttttc tctcccaatt ttctttttac tccccctctt      1380
     aagggggcct tggaatctat agtatagaat gaactgtcta gatggatgaa ttatgataaa      1440
     ggcttaggac ttccaaaggt gattaaatat ttaatgatgt gtcatatgag tcctctaaaa      1500
     aaaaaaaaaa aaaaaaaaaa aaaaaaaa                                         1528
//

If you have problems or comments...

PBIL Back to PBIL home page