(data stored in SCRATCH9089 zone)

EMBL: U52207

ID   U52207; SV 1; linear; genomic DNA; STD; PRO; 987 BP.
XX
AC   U52207;
XX
DT   11-FEB-1998 (Rel. 54, Created)
DT   21-JAN-2000 (Rel. 62, Last updated, Version 2)
XX
DE   Pasteurella multocida serotype 10, outer membrane protein (ompH) gene,
DE   partial cds.
XX
KW   .
XX
OS   Pasteurella multocida
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales;
OC   Pasteurellaceae; Pasteurella.
XX
RN   [1]
RP   1-987
RX   DOI; 10.1016/S0264-410X(98)00266-7.
RX   PUBMED; 10067687.
RA   Luo Y., Zeng Q., Glisson J.R., Jackwood M.W., Cheng I.H., Wang C.;
RT   "Sequence analysis of Pasteurella multocida major outer membrane protein
RT   (OmpH) and application of synthetic peptides in vaccination of chickens
RT   against homologous strain challenge";
RL   Vaccine 17(7-8):821-831(1999).
XX
RN   [2]
RP   1-987
RA   Luo Y., Glisson J.R., Jackwood M.W., Cheng I.N.;
RT   ;
RL   Submitted (25-MAR-1996) to the INSDC.
RL   Yugang Luo, Avian Medicine, The University of Georgia, 953 College Station
RL   Road, Athens, GA 30602, USA
XX
DR   MD5; c66205e077db4b3be18c18bd16d36132.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..987
FT                   /organism="Pasteurella multocida"
FT                   /serotype="10"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:747"
FT   CDS_pept        <1..987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompH"
FT                   /product="outer membrane protein"
FT                   /note="OmpH"
FT                   /db_xref="GOA:Q9CNN9"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CNN9"
FT                   /protein_id="AAC02251.1"
FT                   /translation="ATVYNQDGTKVDVNGSVRLLLKKEKDKRGDLMDNGSRVSFKASHD
FT                   LGEGLSALAYAELRFSKDVKNKDGEVIKQPIGNNVHAKRLYAGFAYEGVGTLTFGNQLT
FT                   IGDDVGVSDYTYFLGGINNLLSSGEKAINFKSAEFNGLTFGGTYVFSDDFDKNGLRDGR
FT                   GFVVAGLYNRKIGDVGFAFEAGYSQKYVKQEVASVLPAPSGSVTVYKDEKEKAFMVGAE
FT                   LSYAGLALGVDYAQSKVTNVDGKKRALEVGLNYDINDKAKVYTDFIWAKEGPKGATTRD
FT                   RSIILGAGYKLHKQVETFVEGGWGREKDANGVTTKDNVVGVGLRVHF"
XX
SQ   Sequence 987 BP; 317 A; 145 C; 229 G; 296 T; 0 other;
     gcaacagttt acaatcaaga cggtacaaaa gttgatgtaa atggttctgt acgtttactc        60
     ctcaaaaaag aaaaagataa acgtggtgat ttaatggata atggttcacg cgtttctttc       120
     aaagcatctc atgacttagg tgaagggtta agtgcgttag catatgcaga acttcgtttt       180
     agtaaagatg tgaaaaacaa agatggtgaa gtgattaaac aaccaattgg taataatgtc       240
     catgctaaac gtctttacgc aggtttcgct tatgaaggtg taggtacatt aacatttggt       300
     aatcaattaa ctatcggtga tgatgttggt gtgtctgact atacatactt cttaggtggt       360
     atcaacaatc ttctttctag tggtgaaaaa gcgattaact ttaaatcagc agaatttaat       420
     ggtttaacat ttggcggtac ttacgttttc tctgatgatt ttgataaaaa cggattacgt       480
     gatggtcgtg gtttcgttgt agcgggttta tataacagaa aaatcggtga tgttggtttc       540
     gcgtttgaag caggctatag ccaaaaatat gtgaaacaag aagtagcttc agtattacca       600
     gcaccttctg gctcagtaac agtttacaaa gatgaaaaag agaaagcatt catggttggt       660
     gcggagttat catatgctgg tttagcactt ggtgttgact acgcacaatc taaagtgact       720
     aacgtggatg gtaaaaaacg tgcacttgaa gtgggcttaa actatgatat taatgataaa       780
     gcaaaagttt acactgattt catttgggca aaagaaggtc caaaaggtgc gactacaaga       840
     gatcgttcta tcatcttagg tgcgggctac aagcttcaca aacaagttga aacctttgtt       900
     gaaggtggct ggggcagaga gaaagatgct aatggcgtaa caacaaaaga caatgttgtt       960
     ggtgttggtt tacgcgtaca cttctaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page