(data stored in SCRATCH zone)

EMBL: U56901

ID   U56901; SV 1; linear; genomic DNA; STD; PRO; 20320 BP.
XX
AC   U56901;
XX
DT   19-JAN-1997 (Rel. 50, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Bacillus subtilis putative transcriptional regulator (yvhJ), Ycr59c/YigZ
DE   homolog (yvhK), histidine kinase (degS),transcriptional regulator of
DE   degradation enzyme (degU), (degV), (comFA), (comFB), (comFC), flagellar
DE   protein (yviB), negative regulator of flagellin (flgM), flagellar protein
DE   (yviC), flagellar-hook associated protein 1 (flgK), flagellar-hook
DE   associated protein 3 (flgL), (yviE), transmembrane protein (yviF), (csrA),
DE   flagellin (hag), flagellar protein (yviH), flagellar hook-associated
DE   protein 2 (fliD), flagellar protein (fliS), flagellar protein (fliT),
DE   sigma-54 modulator homolog (yviI), and (secA) genes, complete cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-20320
RA   Soldo B., Lazarevic V., Mauel C., Karamata D.;
RT   "Sequence of the Bacillus subtilis 168 chromosomal region from 305 to 307
RT   degree";
RL   Unpublished.
XX
RN   [2]
RP   1-20320
RA   Lazarevic V.;
RT   ;
RL   Submitted (29-APR-1996) to the INSDC.
RL   Vladimir Lazarevic, Institut de Genetique et de Biologie Microbiennes, Rue
RL   Cesar-Roux 19, Lausanne, 1005, Switzerland
XX
DR   MD5; 90572cdafdacead851b7520eeef225f3.
DR   EuropePMC; PMC97303; 10678962.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..20320
FT                   /organism="Bacillus subtilis"
FT                   /map="305-307 degree"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   stem_loop       6..42
FT   CDS_pept        complement(42..1217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvhJ"
FT                   /product="putative transcriptional regulator"
FT                   /note="probably membrane-anchored."
FT                   /db_xref="GOA:P96499"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="PDB:3NXH"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96499"
FT                   /protein_id="AAC44935.1"
FT                   /translation="MAERVRVRVRKKKKSKRRKILKRIMLLFALALLVVVGLGGYKLYK
FT                   TINAADESYDALSRGNKSNLRNEVVDMKKKPFSILFMGIEDYATKGQKGRSDSLIVVTL
FT                   DPKNKTMKMLSIPRDTRVQLAGDTTGSKTKINAAYSKGGKDETVETVENFLQIPIDKYV
FT                   TVDFDGFKDVINEVGGIDVDVPFDFDEKSDVDESKRIYFKKGEMHLNGEEALAYARMRK
FT                   QDKRGDFGRNDRQKQILNALIDRMSSASNIAKIDKIAEKASENVETNIRITEGLALQQI
FT                   YSGFTSKKIDTLSITGSDLYLGPNNTYYFEPDATNLEKVRKTLQEHLDYTPDTSTGTSG
FT                   TEDGTDSSSSSGSTGSTGTTTDGTTNGSSYSNDSSTSSNNSTTNSTTDSSY"
FT   CDS_pept        complement(1217..1870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvhK"
FT                   /product="Ycr59c/YigZ homolog"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32437"
FT                   /protein_id="AAC44936.1"
FT                   /translation="MLHSYFTVKEAGEHEIVIEKSRFICHLSRVSTEQEAQEFIQKIKK
FT                   QHWNATHNCSAYVIGENDHIQKANDDGEPSGTAGVPMLEVLKKRRLKDTCAVVTRYFGG
FT                   IKLGAGGLIRAYGKSVSEGLNHIGVVERKLMRIMHTSADYTWLGKIENELRESQFLLKE
FT                   IHYSENVEFETYVEEKETNAFSEWMTELTNGKSDIKEGELTYLEKAVNHIKETE"
FT   regulatory      complement(1226..1232)
FT                   /gene="yvhK"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      2076..2082
FT                   /gene="degS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2087..3244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degS"
FT                   /product="histidine kinase"
FT                   /function="phosphorylates degU"
FT                   /db_xref="GOA:P13799"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008595"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016381"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13799"
FT                   /protein_id="AAC44937.1"
FT                   /translation="MNKTKMDSKVLDSILMKMLKTVDGSKDEVFQIGEQSRQQYEQLVE
FT                   ELKQIKQQVYEVIELGDKLEVQTRHARNRLSEVSRNFHRFSEEEIRNAYEKAHKLQVEL
FT                   TMIQQREKQLRERRDDLERRLLGLQEIIERSESLVSQITVVLNYLNQDLREVGLLLADA
FT                   QAKQDFGLRIIEAQEEERKRVSREIHDGPAQMLANVMMRSELIERIFRDRGAEDGFQEI
FT                   KNLRQNVRNALYEVRRIIYDLRPMALDDLGLIPTLRKYLYTTEEYNGKVKIHFQCIGET
FT                   EDQRLAPQFEVALFRLAQEAVSNALKHSESEEITVKVEITKDFVILMIKDNGKGFDLKE
FT                   AKEKKNKSFGLLGMKERVDLLEGTMTIDSKIGLGTFIMIKVPLSL"
FT   regulatory      3312..3318
FT                   /gene="degU"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3327..4016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degU"
FT                   /product="transcriptional regulator of degradation enzymes"
FT                   /db_xref="GOA:P13800"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13800"
FT                   /protein_id="AAC44938.1"
FT                   /translation="MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDDGDEAARIV
FT                   EHYHPDVVIMDINMPNVNGVEATKQLVELYPESKVIILSIHDDENYVTHALKTGARGYL
FT                   LKEMDADTLIEAVKVVAEGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYPEIRRPL
FT                   HILTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAVVVAIK
FT                   NGWVEMR"
FT   stem_loop       4023..4054
FT   regulatory      4096..4104
FT                   /gene="degV"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4114..4959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degV"
FT                   /db_xref="GOA:P32436"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="PDB:3FYS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32436"
FT                   /protein_id="AAC44939.1"
FT                   /translation="MNIAVVTDSTAYIPKEMREQHQIHMIPLQVVFREETYREEIELDW
FT                   KSFYEEVKKHNELPTTSQPPIGELVALYEELGKSYDAVISIHLSSGISGTFSSAAAADS
FT                   MVDNIDVYPFDSEISCLAQGFYALKAAELIKNGASSPEDIIKELEEMKKTVRAYFMVDD
FT                   LAHLQRGGRLSSAQAFIGSLLKVKPILHFDNKVIVPFEKIRTRKKAISRIYELLDEDAS
FT                   KGLPMRAAVIHANREEEAAKIIEELSAKYPHVEFYNSYFGAVIGTHLGEGALGICWCFK
FT                   "
FT   stem_loop       4964..4990
FT   regulatory      5048..5056
FT                   /gene="comFA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        5065..6456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comFA"
FT                   /note="involved in transformation"
FT                   /db_xref="GOA:P39145"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39145"
FT                   /protein_id="AAC44940.1"
FT                   /translation="MNVPVEKNSSFSKELQQTLRSRHLLRTELSFSDEMIEWHIKNGYI
FT                   TAENSISINKRRYRCNRCGQTDQRYFSFYHSSGKNKLYCRSCVMMGRVSEEVPLYSWKE
FT                   ENESNWKSIKLTWDGKLSSGQQKAANVLIEAISKKEELLIWAVCGAGKTEMLFPGIESA
FT                   LNQGLRVCIATPRTDVVLELAPRLKAAFQGADISALYGGSDDKGRLSPLMISTTHQLLR
FT                   YKDAIDVMIIDEVDAFPYSADQTLQFAVQKARKKNSTLVYLSATPPKELKRKALNGQLH
FT                   SVRIPARHHRKPLPEPRFVWCGNWKKKLNRNKIPPAVKRWIEFHVKEGRPVFLFVPSVS
FT                   ILEKAAACFKGVHCRTASVHAEDKHRKEKVQQFRDGQLDLLITTTILERGVTVPKVQTG
FT                   VLGAESSIFTESALVQIAGRTGRHKEYADGDVIYFHFGKTKSMLDARKHIKEMNELAAK
FT                   VECTD"
FT   regulatory      6502..6507
FT                   /gene="comFB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6516..6812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comFB"
FT                   /db_xref="GOA:P39146"
FT                   /db_xref="InterPro:IPR019657"
FT                   /db_xref="PDB:4WAI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39146"
FT                   /protein_id="AAC44941.1"
FT                   /translation="MLVNSKEIVMKELLDRYMDQLHMACTCQVCQNDVLALSLNKVSPS
FT                   YVTDFKKIAYTKAELVDKQKNTAMLVILAESAAVVSESPSDLCQTKQEEAFIN"
FT   regulatory      6791..6798
FT                   /gene="comFC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6809..7498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comFC"
FT                   /note="involved in transformation"
FT                   /db_xref="GOA:P39147"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005222"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39147"
FT                   /protein_id="AAC44942.1"
FT                   /translation="MICLLCDSQFSQDVTWRALFLLKPDEKVCYSCRSKLKKITGHICP
FT                   LCGRPQSVHAVCRDCEVWRTRIRDSLLLRQNRSVYTYNDMMKETLSRFKFRGDAEIINA
FT                   FKSDFSSTFSKVYPDKHFVLVPIPLSKEREEERGFNQAHLLAECLDRPSHHPLIRLNNE
FT                   KQSKKKKTERLLSECIFDTKNNSAEGMNIILIDDLYTTGATLHFAARCLLEKGKAASVS
FT                   SFTLIRS"
FT   stem_loop       7489..7507
FT   regulatory      7558..7563
FT                   /gene="yviB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        7572..7991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yviB"
FT                   /product="flagellar protein"
FT                   /db_xref="GOA:P39807"
FT                   /db_xref="InterPro:IPR022258"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39807"
FT                   /protein_id="AAC44943.1"
FT                   /translation="MGELANCPKCNALFLKTKLQTVCQACIKEEEKSFETVYKFLRKQE
FT                   NRQSTLSRITEETGVEEELILKFIRQKRIQITHLPNLAYPCERCGTSIREGKFCKACQS
FT                   DIKDQMDHLNHEDALKIEKENSKKDTYYAYNTKNS"
FT   regulatory      8060..8066
FT                   /gene="flgM"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8072..8338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgM"
FT                   /product="negative regulator of flagellin synthesis"
FT                   /db_xref="GOA:P39809"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39809"
FT                   /protein_id="AAC44944.1"
FT                   /translation="MKINQFGTQSVNPYQKNYDKQAVQKTVAQPQDKIEISSQAKEMQH
FT                   ASDAVTGSRQEKIAQLKAQIENGSYKVDANHIAKNMINFYKKQ"
FT   regulatory      8340..8346
FT                   /gene="yviC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8354..8836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yviC"
FT                   /product="flagellar protein"
FT                   /db_xref="GOA:P39808"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39808"
FT                   /protein_id="AAC44945.1"
FT                   /translation="MSAKAIIEQLKRLCVLHEHLLTLSEEKTEALKAGKTKELSNILTK
FT                   EQKYIQAITQTEDDRIKTTSAFLGYSENNTISACIAKTSGSEKEELEQLYESLSQVLGR
FT                   LKKVNEMNRQLTRDALQFISISYDMLVPKENNFNYSKSIKAELPKSSKMKLFDSKA"
FT   regulatory      8838..8845
FT                   /gene="flgK"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8855..10378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /product="flagellar-hook associated protein 1 (HAP1)"
FT                   /db_xref="GOA:P39810"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39810"
FT                   /protein_id="AAC44946.1"
FT                   /translation="MTSTFMGLETARRALSAQQAALSTTANNVANANTDGYTRQRVSLE
FT                   ATDYFPAVSKNAEKTAGQMGTGVQGKSVERIRDIFLDYQYRLQNNSAGYYDTKAKALSQ
FT                   MEGVLNETDDSGLNSVLNSFWNSLQELSNNTNEESARSVVARKGQAVAETFNYISESLT
FT                   NVQSNLKAELNTTVLDVNSLLSQLNSLNKQIAQVEPVGLLPNGLYDQRDLLIDKLSSMV
FT                   DIKVSYNKSGGNALASAEGTVSIEILDKNKQSLGTVLDGKNYEVSELAANYDNETGLVS
FT                   SISIGDTAVQAESFSSKGSLLGFIESYGYITADGQEKGVYPEMLSDLDNMALEFAKAFN
FT                   EVHRNGVTKSGEQGGDFFDFTGGETEPAKGAAGKIKVADSIIDSKGANIAFSLTGAAND
FT                   NANATKLANVLTGKITINGKETSVLDYYAGLIGELGIEAQEANRLASNTETQLNDADIN
FT                   RQQMSAVSLDEEMTNMIQFQHAYNAAARMVTLQDELLDKVINGMGVGGR"
FT   regulatory      10369..10375
FT                   /gene="flgL"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        10389..11285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /product="flagellar-hook associated protein 3 (HAP3)"
FT                   /db_xref="GOA:P96501"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96501"
FT                   /protein_id="AAC44947.1"
FT                   /translation="MRVTQGMIQQNSLRYIGSSYSKLDKLQSQISSGKKISKASDDPVV
FT                   AMKSLKYNTQLSQVQQYKSNASQAFTWLENTETNITEGIDILSKVRELAVEAQNDTNGE
FT                   PERQAIGVEVKQLKEQLLNIANTQVNGRYIFNGTNSDKPPVTDNGDGTYTISDTADVVV
FT                   NISNNMSLKVNSDPKSAFGGTSESGQNVFEMLDSFEKALNSGSLDGMDSVLNDIDHFSD
FT                   GMSAERSDLGARYNRLELVNTRLSAQEETATKVLSDNEDVELEEVITEFIAQQSVHRAT
FT                   LAVNAQIVQPTLIDFLK"
FT   stem_loop       11284..11306
FT   regulatory      11319..11325
FT                   /gene="yviE"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        11332..11907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yviE"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96502"
FT                   /protein_id="AAC44948.1"
FT                   /translation="MQIPRLIMHSVQGKIGLTTTPASLKMEQPQADLEIEQPSAEMEIS
FT                   VTPGKLTIDQTQAWEELDRKHVFKRIEEAAQQGHEDVMEGIARTAEEGDELMKIENKGN
FT                   PIASQARRNSEMHQIQLGENYAPSLSRVKIQYTPSQLDVQITPRKPVIQAEPHKPIVEY
FT                   TPGNVKVDMLQYPDLNIDVEYPKESPEK"
FT   regulatory      11913..11918
FT                   /gene="yviF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        11928..12359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yviF"
FT                   /product="transmembrane protein"
FT                   /db_xref="GOA:P96503"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96503"
FT                   /protein_id="AAC44949.1"
FT                   /translation="MIIHTKYHGQMNIKEEQIILFESGIPGFLEEKQFVILPLSEDSPF
FT                   VALQSVTSENLAFIVVSPFIFFKNYEFDLDESTAELLDIDNIQDVEVMTILTMAEPFEK
FT                   STANLLAPIIVNRKNMMAKQVVLHDSSYTTKHPIGGESC"
FT   regulatory      12342..12348
FT                   /gene="csrA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        12353..12577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /note="could accelerate degradation of certain transcripts"
FT                   /db_xref="GOA:P33911"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="PDB:1T3O"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33911"
FT                   /protein_id="AAC44950.1"
FT                   /translation="MLVLSRKINEAIQIGADIEVKVIAVEGDQVKLGIDAPKHIDIHRK
FT                   EIYLTIQEENNRAAALSSDVISALSSQKK"
FT   stem_loop       12559..12581
FT   regulatory      12706..12713
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        12722..13636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hag"
FT                   /product="flagellin"
FT                   /db_xref="GOA:P02968"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="PDB:5MAW"
FT                   /db_xref="PDB:5WJT"
FT                   /db_xref="PDB:6GOW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02968"
FT                   /protein_id="AAC44951.1"
FT                   /translation="MRINHNIAALNTLNRLSSNNSASQKNMEKLSSGLRINRAGDDAAG
FT                   LAISEKMRGQIRGLEMASKNSQDGISLIQTAEGALTETHAILQRVRELVVQAGNTGTQD
FT                   KATDLQSIQDEISALTDEIDGISNRTEFNGKKLLDGTYKVDTATPANQKNLVFQIGANA
FT                   TQQISVNIEDMGADALGIKEADGSIAALHSVNDLDVTKFADNAADTADIGFDAQLKVVD
FT                   EAINQVSSQRAKLGAVQNRLEHTINNLSASGENLTAAESRIRDVDMAKEMSEFTKNNIL
FT                   SQASQAMLAQANQQPQNVLQLLR"
FT   stem_loop       13643..13671
FT   regulatory      13856..13861
FT                   /gene="yviH"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        13869..14198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yviH"
FT                   /product="flagellar protein"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="PDB:2HC5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39737"
FT                   /protein_id="AAC44952.1"
FT                   /translation="MNIERLTTLQPVWDRYDTQIHNQKDNDNEVPVHQVSYTNLAEMVG
FT                   EMNKLLEPSQVHLKFELHDKLNEYYVKVIEDSTNEVIREIPPKRWLDFYAAMTEFLGLF
FT                   VDEKK"
FT   regulatory      14203..14211
FT                   /gene="fliD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        14216..15712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /product="flagellar hook-associated protein 2"
FT                   /db_xref="GOA:P39738"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39738"
FT                   /protein_id="AAC44953.1"
FT                   /translation="MVTRITGLASGMDIDDIVSKLMQTERAPLDKLTQKKQTLEWQRDS
FT                   YREVNSKIKELQDYMSKNTLTYPSTYQSKTVTSSNESVLTATGSVSAPNSSSTVEVASL
FT                   ATAATYKANNYTGYTQGDYNLAFNVVAPGETTAKTVNISVTSADTIDNVISKLNSSDLG
FT                   VSAFKDKIWNGTEYVETIAFSSKATGAGGSIQAADSATADFMSGQLGFSLDADNKLTAY
FT                   KEGTNAKVTINGFEMEKLTNNFTVNGVTYSIKNTTAATGPVTTSVSTDVDGIYNQIKEF
FT                   VDKYNELVDSLNEKLKEEKYRDYTPLTSEQKEAMSDKEVELWEEKAKSGLLRNDSSIST
FT                   GTNQMRTDFYTQVNADGKTYQLTEFGITTSSAYQLRGHLEINEEKLKAKIAEDPQGVAN
FT                   LFTSGTNDSNYSDKGIMKRITNTLRSTVKSIEAKAGNSTMGASSYSIGKNLNSISTEIT
FT                   DMQDRLNTIENRYYSKFSAMDSAIQKMNEQASYLSQLLVQ"
FT   regulatory      15722..15726
FT                   /gene="fliS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        15734..16135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /product="flagellar protein"
FT                   /db_xref="GOA:P39739"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="PDB:1VH6"
FT                   /db_xref="PDB:5MAW"
FT                   /db_xref="PDB:6GOW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39739"
FT                   /protein_id="AAC44954.1"
FT                   /translation="MAIQNPYTAYQQNSVNTATPGELTLMLYNGCLKFIRLAAQAIEND
FT                   DMERKNENLIKAQNIIQELNFTLNRNIELSASMGAMYDYMYRRLVQANIKNDTGMLAEV
FT                   EGYVTDFRDAWKQAIQSERKDRHGSGGIA"
FT   regulatory      16120..16127
FT                   /gene="fliT"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        16132..16473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliT"
FT                   /product="flagellar protein"
FT                   /db_xref="GOA:P39740"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39740"
FT                   /protein_id="AAC44955.1"
FT                   /translation="MNNIDQLYTETKSMLSHIQNTPESDELLKQIEDFVATRSELIQEI
FT                   SLPLSEEERKQMKLILTWDQLIVKEMERLKQSIATELQQMKRKRVMHTTYLNPYNNITI
FT                   DGTYYDKRK"
FT   stem_loop       16599..16624
FT   regulatory      17034..17041
FT                   /gene="yviI"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        17051..17620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yviI"
FT                   /product="sigma-54 modulator homolog"
FT                   /db_xref="GOA:P28368"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28368"
FT                   /protein_id="AAC44956.1"
FT                   /translation="MNYNIRGENIEVTPALKDHVERKIGKLERYFDHSVDADVNVNLKF
FT                   YNDKESKVEVTIPMTDLALRSEVHNEDMYNAIDLATNKLERQIRKHKTKVNRKFREQGS
FT                   PKYLLANGLGSDTDIAVQDDIEEEESLDIVRQKRFNLKPMDSEEAILQMNMLGHNFFVF
FT                   TNAETNLTNVVYRRNDGKYGLIEPTE"
FT   stem_loop       17626..17658
FT   regulatory      17773..17779
FT                   /gene="secA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        17788..20313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /note="involved in protein export"
FT                   /db_xref="GOA:P28366"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="PDB:1M6N"
FT                   /db_xref="PDB:1M74"
FT                   /db_xref="PDB:1TF2"
FT                   /db_xref="PDB:1TF5"
FT                   /db_xref="PDB:2IBM"
FT                   /db_xref="PDB:3DL8"
FT                   /db_xref="PDB:3IQM"
FT                   /db_xref="PDB:3IQY"
FT                   /db_xref="PDB:3JV2"
FT                   /db_xref="PDB:5EUL"
FT                   /db_xref="PDB:6ITC"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28366"
FT                   /protein_id="AAC44957.1"
FT                   /translation="MLGILNKMFDPTKRTLNRYEKIANDIDAIRGDYENLSDDALKHKT
FT                   IEFKERLEKGATTDDLLVEAFAVVREASRRVTGMFPFKVQLMGGVALHDGNIAEMKTGE
FT                   GKTLTSTLPVYLNALTGKGVHVVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDE
FT                   KREAYAADITYSTNNELGFDYLRDNMVLYKEQMVQRPLHFAVIDEVDSILIDEARTPLI
FT                   ISGQAAKSTKLYVQANAFVRTLKAEKDYTYDIKTKAVQLTEEGMTKAEKAFGIDNLFDV
FT                   KHVALNHHINQALKAHVAMQKDVDYVVEDGQVVIVDSFTGRLMKGRRYSEGLHQAIEAK
FT                   EGLEIQNESMTLATITFQNYFRMYEKLAGMTGTAKTEEEEFRNIYNMQVVTIPTNRPVV
FT                   RDDRPDLIYRTMEGKFKAVAEDVAQRYMTGQPVLVGTVAVETSELISKLLKNKGIPHQV
FT                   LNAKNHEREAQIIEEAGQKGAVTIATNMAGRGTDIKLGEGVKELGGLAVVGTERHESRR
FT                   IDNQLRGRSGRQGDPGITQFYLSMEDELMRRFGAERTMAMLDRFGMDDSTPIQSKMVSR
FT                   AVESSQKRVEGNNFDSRKQLLQYDDVLRQQREVIYKQRFEVIDSENLREIVENMIKSSL
FT                   ERAIAAYTPREELPEEWKLDGLVDLINTTYLDEGALEKSDIFGKEPDEMLELIMDRIIT
FT                   KYNEKEEQFGKEQMREFEKVIVLRAVDSKWMDHIDAMDQLRQGIHLRAYAQTNPLREYQ
FT                   MEGFAMFEHMIESIEDEVAKFVMKAEIENNLEREEVVQGQTTAHQPQEGDDNKKAKKAP
FT                   VRKVVDIGRNAPCHCGSGKKYKNCCGRTE"
XX
SQ   Sequence 20320 BP; 6586 A; 3837 C; 4523 G; 5374 T; 0 other;
     tgcgcaaaaa tgcccgatcc tctaaaagga ccgggcattt tttaatagga tgaatcagtt        60
     gttgaattcg ttgtactgtt gtttgagctt gtgctgctgt cattcgaata gctgcttccg       120
     ttcgtcgtcc cgtcagttgt tgtgccagtg ctgccagtgc tgccagaact gcttgagctg       180
     tcagtcccgt cttcggtacc ggaagtgcca gtgcttgtat caggagtata atctaaatgc       240
     tcttgaagcg tttttctgac tttctcgaga tttgtagcat caggttcaaa gtaatatgtg       300
     ttgttaggcc ctaaatacaa atcagaacct gtaatgctca atgtgtcgat ttttttgctg       360
     gtaaagccgc tgtaaatctg ctgaagcgct aaaccttcag taatgcgaat attggtttca       420
     acgttttcgc tggctttttc tgcgatttta tcaattttag caatgttgct tgcacttgac       480
     atgcggtcaa tcagcgcgtt taagatttgt ttttgtctgt cattacggcc aaagtctccg       540
     cgtttatcct gttttctcat ccgggcatat gctaaggctt cttcgccgtt caaatgcatc       600
     tcgccttttt tgaagtaaat ccgtttgctt tcgtctacat cacttttttc atcgaaatcg       660
     aaaggcacgt caacatcaat accgccgact tcattaatca catctttaaa tccgtcaaaa       720
     tcaactgtga catatttatc gatcgggatt tgcaagaagt tttcaacagt ttcaactgtt       780
     tcatctttac cgcctttgct gtaagcggca ttgatcttcg tcttgcttcc cgttgtgtca       840
     ccagctaatt gcacacgtgt gtcacgcgga atgctcagca ttttcatggt tttatttttg       900
     ggatccaggg taacaacaat aagagagtct gatctccctt tttgtccttt agtcgcgtaa       960
     tcctctattc ccataaataa aatagaaaat ggttttttct tcatgtctac aacttcgttg      1020
     cgaagatttg atttattccc gcgggatagg gcatcgtacg attcatccgc agcgttaatg      1080
     gttttataaa gtttataccc gccaagccct acaactacca atagtgcaag ggcgaacaat      1140
     aacattattc tttttaaaat tttcctacgt ttgctctttt tcttttttcg cacacgcact      1200
     ctaacgcgtt cagccattat tcagtctcct ttatgtgatt gacggctttt tcaagatacg      1260
     tcaactctcc ctctttaata tcactctttc catttgtcag ttctgtcatc cattcagaaa      1320
     aagcgttggt ttctttttct tccacgtatg tttcgaattc aacattttct gaataatgga      1380
     tttcctttaa cagaaattgt gactccctta attcattttc aatcttgcca agccatgtgt      1440
     aatctgcaga agtatgcatg attcgcataa gcttccgttc tacaacacct atatgattta      1500
     atccttcaga cactgatttc ccataagcgc gaattaatcc gccagcacca agcttaatgc      1560
     ctccgaagta gcgtgtaacg acggcgcaag tatccttcag cctgcgtttt tttaaaacct      1620
     cgagcatcgg cactcccgct gtaccgcttg gttccccgtc atcattggct ttttggatat      1680
     gatcattctc gccaataaca taagccgagc aattatgagt cgcattccag tgctgtttct      1740
     ttattttctg tataaattcc tgtgcctctt gttcggtaga aacacggctt aaatgacaga      1800
     taaaacgcga tttttctata acaatctcgt gttctcccgc ttctttcaca gtaaaatagc      1860
     tgtgcagcat gctagctgac cctcctgcta agcataaaag actgcctata caaattcgta      1920
     cagtctttag aatttttgtg cgtattttgg tatcataaag agtagatagt atataaaaat      1980
     gtttttttct agaatatacg cattctttca ttataattcg acataatttg cagatcaatt      2040
     acatttataa taaaaatata tgacaacgcc gtgacggagg gaaattatga ataaaacaaa      2100
     gatggattcc aaagtgctgg attctatttt gatgaagatg ctgaaaaccg ttgacgggag      2160
     caaggacgag gtttttcaaa tcggggagca gtcacgccag cagtatgaac agctggtcga      2220
     agaactgaaa caaattaaac agcaggtgta tgaagtgatt gagcttggcg ataaacttga      2280
     agtgcaaact cgccatgcga gaaaccgttt atccgaggtc agccgtaatt ttcatagatt      2340
     cagtgaagag gaaatccgca atgcttatga aaaagcccat aagctgcagg tagaattgac      2400
     gatgatccag cagcgtgaga agcaattgcg cgaacggcgg gacgatttgg agcgcagatt      2460
     gctagggctt caggaaatca ttgagcggtc agaatcatta gtaagccaaa ttacagttgt      2520
     gctcaactac ttgaatcagg atttgcgcga agttggactg cttcttgctg atgctcaggc      2580
     aaaacaggat ttcggcttaa gaattattga ggcgcaggaa gaagagcgaa aaagagtctc      2640
     aagagaaatc catgacggac ccgctcaaat gctggcgaat gttatgatga gatcggaatt      2700
     aatcgagcgg attttccgtg accggggcgc agaggacgga ttccaagaaa ttaaaaatct      2760
     ccgccaaaat gttcggaatg ccctttacga agtgagaagg attatatatg atttaagacc      2820
     gatggccctt gatgacctag gcctgattcc aactttaaga aaatatctat atacaaccga      2880
     ggaatataac gggaaggtca aaatacattt tcagtgcatt ggagaaacag aggatcagag      2940
     gctagcgcct cagtttgagg ttgcgctctt caggctcgca caggaagctg tgtctaatgc      3000
     gctaaagcat tctgaatctg aagaaattac agtcaaagtt gagatcacaa aggattttgt      3060
     gattttaatg ataaaagata acggtaaagg gttcgacctg aaggaagcga aagagaagaa      3120
     aaacaaatca ttcggcttgc tgggcatgaa agaaagagta gatttattgg aaggaacgat      3180
     gacaatagat tcgaaaatag gtcttgggac atttattatg attaaggttc cgttatctct      3240
     ttgactatga tttgtaaaat agagccaaaa ggcatattga ccgaatgcta gagtatatag      3300
     aacaataata caaggaggcg tggcttgtga ctaaagtaaa cattgttatt atcgacgacc      3360
     atcagttatt tcgtgaaggt gttaaacgga tattggattt tgaacctacc tttgaagtgg      3420
     tagccgaagg tgatgacggg gacgaagcgg ctcgtattgt tgagcactat catcctgatg      3480
     ttgtgatcat ggatatcaat atgccaaacg taaatggtgt ggaagctaca aaacagcttg      3540
     tagagctgta tcctgaatct aaagtaatta ttctatcaat tcacgatgac gaaaattatg      3600
     taacacatgc cctgaaaaca ggtgcaagag gttatctgct gaaagagatg gatgctgata      3660
     cattaattga agcggttaaa gtagtggctg agggcggatc ttacctccat ccgaaggtta      3720
     ctcacaacct cgttaacgaa ttccgccgcc ttgcaacaag cggagtttct gcacaccctc      3780
     aacatgaggt ttaccctgaa atccgcagac cattacatat tttaactagg cgggaatgtg      3840
     aagtgctgca gatgcttgca gacggaaaaa gcaaccgcgg tattggtgaa tcattgttta      3900
     tcagtgagaa aaccgttaaa aaccatgtca gcaatatttt acaaaaaatg aatgtaaacg      3960
     accggacgca agccgttgtg gtcgccatta aaaatggctg ggtagaaatg agatagtata      4020
     ataggagact tgccttttac taggcaggtc tttttttagg ctgccgtttc ccttacaata      4080
     gagttataaa gcaataaggc aggtatcgaa gctatgaata ttgcagtcgt aacagacagc      4140
     acggcatata ttccgaaaga aatgcgtgaa caacatcaga tacatatgat ccctctccag      4200
     gttgttttta gggaggagac ttaccgtgaa gaaattgagt tggactggaa aagcttttat      4260
     gaagaagtga aaaaacataa tgagctcccg acgacttctc agccgccaat cggcgagctg      4320
     gttgcgttgt atgaagagct tggcaagtct tatgatgcgg ttatcagtat ccatctttcc      4380
     agcgggatca gcggaacatt cagcagtgca gcagcggctg attcgatggt cgacaatatt      4440
     gatgtgtatc catttgactc agagatcagc tgcttggctc aaggctttta tgcccttaaa      4500
     gctgctgaat taatcaaaaa cggagcatca tcgccggaag atattataaa agaactggaa      4560
     gaaatgaaaa aaacagttcg agcttatttt atggtagatg acttagccca tcttcagcgc      4620
     ggcgggcgat taagcagcgc ccaagccttc attggtagtc ttctaaaggt aaagcctatc      4680
     cttcattttg acaataaggt aattgtgcct tttgagaaga ttcgcacacg taaaaaagca      4740
     atttcgcgaa tttatgagct tttagacgaa gatgcgagta aagggttgcc tatgcgagct      4800
     gctgttatcc acgctaatcg agaggaagaa gcagcgaaaa tcattgaaga gctttctgca      4860
     aaatatcctc atgttgaatt ttataacagc tattttggcg cggtaatcgg cactcatttg      4920
     ggtgaaggtg cgttaggaat ttgctggtgt tttaaataag gccaaatctc cgtttttaga      4980
     gcggagattt ttttatattc ttattttaat agttggacag aaaatattca ttcaggcata      5040
     ctgtttcgaa aggaggcgtg ctatgtgaat gtgccagttg aaaaaaacag ttccttttca      5100
     aaagaattgc agcagacgct tcgaagccgt catttgctca ggactgagct ctcattttcc      5160
     gatgagatga ttgaatggca tatcaagaat ggatatatca ctgctgaaaa ttctatatcc      5220
     ataaataaac ggagatatag atgtaatagg tgcggacaaa ctgatcagcg gtatttttct      5280
     ttttatcact catctggaaa gaataagctg tattgccgtt cctgtgtcat gatgggcaga      5340
     gtgagtgagg aggttccttt atattcatgg aaagaggaaa atgaatcaaa ctggaagtct      5400
     attaagctga catgggatgg caagctttca agcggacagc aaaaagccgc caatgtttta      5460
     attgaagcaa tatcaaaaaa agaagagctc ctcatctggg cggtttgcgg cgctggcaaa      5520
     acagaaatgc tgtttcctgg tatagaatca gcgttaaatc aaggactgcg tgtatgtatt      5580
     gcaacacctc gcaccgatgt tgtattagag cttgctccaa gactcaaggc tgcctttcag      5640
     ggtgctgaca tttcagcgct ttacggagga agcgatgaca aagggcggct atctccgctt      5700
     atgatttcca ctacgcatca gcttttgcga tataaagatg caatcgatgt tatgatcatt      5760
     gatgaagttg acgcttttcc atattctgct gatcaaaccc ttcaattcgc tgttcaaaaa      5820
     gcaagaaaga aaaacagcac cctcgtttat ttaagtgcaa cacctcctaa agaattaaaa      5880
     agaaaagcac tgaacggaca gttacattca gttcgcatcc ccgcaagaca ccaccggaaa      5940
     cctttacccg aaccgcgctt tgtatggtgt ggaaactgga agaagaaatt aaaccgaaat      6000
     aaaattccgc cagcggtgaa aagatggata gagtttcatg taaaagaagg gaggcctgtt      6060
     tttttattcg ttccttccgt ttctattctg gaaaaggctg ctgcgtgctt taaaggtgtt      6120
     cattgccgaa ccgcatctgt gcacgcggaa gacaagcata gaaaggagaa agtgcagcaa      6180
     ttcagagatg gtcagctcga tctattaatc acaacaacaa tactggaaag aggcgtcaca      6240
     gtccccaagg tgcaaacggg tgtactagga gcggaatcgt ctatctttac ggaaagcgca      6300
     cttgttcaaa ttgcaggaag aaccggccgg cataaagaat atgcggacgg cgatgtcatt      6360
     tactttcact tcggcaaaac aaagagtatg ctcgatgcaa gaaagcatat aaaagaaatg      6420
     aatgaattgg cagcaaaagt tgaatgtaca gactagccat tatttgaaaa cgtggtacag      6480
     tatactcata taaccgatga tgaggagctg taaaaatgct tgtcaattca aaagaaatcg      6540
     taatgaaaga actgctcgac cgatatatgg accagcttca tatggcctgt acttgccaag      6600
     tatgccaaaa cgatgtattg gcactttctt taaacaaagt gagtccatcc tacgttactg      6660
     attttaaaaa gatcgcatat acgaaagctg agctggtaga taaacaaaaa aacacagcaa      6720
     tgcttgtcat tttggctgaa tctgctgcag tagtttcaga gagtccaagc gatttatgtc      6780
     aaacgaagca ggaggaggca ttcataaact gatctgttta ttatgtgatt cgcaattttc      6840
     tcaagatgtt acatggagag cccttttttt actaaagcct gatgaaaagg tttgttattc      6900
     ttgcagaagc aaattaaaga aaatcacagg acatatctgc cccctgtgcg gcagacctca      6960
     atctgttcat gccgtatgca gggattgcga ggtgtggaga acaaggatca gagacagttt      7020
     gctattgcgt caaaaccgtt cagtttacac atataatgat atgatgaaag aaacgctctc      7080
     ccgttttaaa tttagaggag atgcagaaat cataaatgca tttaaaagtg atttttcttc      7140
     aaccttttct aaggtttacc ccgataagca ttttgttctt gtacctattc cgctgagcaa      7200
     ggaacgggaa gaagagcgcg gatttaacca ggcacatctc ttggcagaat gtttagaccg      7260
     gccttcccac catcccctca ttcgcctgaa taatgagaaa cagtcaaaga aaaagaaaac      7320
     agaacgcctg ctgtcagagt gcatttttga tacaaaaaat aattcagcag aaggtatgaa      7380
     tatcatttta atagacgatc tttatacaac aggcgccacc ttgcacttcg cagcccgctg      7440
     cttattagaa aaaggaaaag ccgcttcagt gtcatctttt accttgatca gaagctaaat      7500
     gattctgttt ttatgccgat ataatcacta gaaattgaca caggcatatt atctaataag      7560
     gagaaaaaaa gatgggagaa ctggctaatt gtccgaaatg caatgcttta tttttaaaaa      7620
     caaagctgca aaccgtatgt caggcgtgta ttaaggaaga agaaaaatca tttgagactg      7680
     tctataaatt tttaagaaaa caggaaaacc ggcaatcaac tttgagccgg ataactgagg      7740
     aaacaggtgt ggaagaagag ctgatattga aattcatcag gcagaagcga attcagatca      7800
     ctcatcttcc taatttggca tacccttgtg aaaggtgcgg gacatcgatt agagaaggca      7860
     agttctgcaa ggcttgccag tctgatatta aggatcaaat ggatcatttg aaccacgagg      7920
     atgctctgaa aatcgagaaa gaaaatagta aaaaagacac atactatgcc tataatacca      7980
     aaaacagctg attccctaaa ctaactgaaa acgcagtcga taaaagggtt aagattgttt      8040
     aaagactgca acggaaagcg agaggaatcc tatgaaaatc aatcaatttg gaacacaatc      8100
     cgttaatcca tatcaaaaaa attatgataa gcaagcggtg caaaaaactg ttgcacaacc      8160
     tcaagataaa attgaaattt catcacaggc taaagaaatg caacatgcat ccgacgcagt      8220
     cactggttca cgacaggaaa aaattgcgca gcttaaagcg caaattgaaa acgggtcata      8280
     caaagtagac gcaaatcata ttgcgaaaaa tatgattaat ttttataaaa agcaataaaa      8340
     aaggagaaag cccatgtcag cgaaggcaat tattgaacaa ttgaagcgac tttgcgttct      8400
     gcatgagcac ctgctcacgc tgtctgaaga aaagacggaa gcgctcaaag ccggcaaaac      8460
     aaaagagctt tctaacattt tgacaaaaga gcaaaaatat attcaagcaa tcacgcagac      8520
     agaagatgac cggatcaaaa caacttcggc ctttctcgga tatagcgaaa ataatactat      8580
     ttccgcatgt atcgccaaaa cctcaggcag tgaaaaggaa gagctggaac aactatacga      8640
     atctctttct caagttctcg gacgtctgaa aaaagtaaat gagatgaata ggcagctgac      8700
     aagagacgcg ctgcaattca tctctatttc gtacgatatg ctggttccta aggaaaataa      8760
     cttcaattac agcaaatcaa ttaaagctga gctgccgaaa agtagcaaaa tgaaactgtt      8820
     tgattcaaaa gcttagcaga aaggaattca gaaaatgaca tctaccttta tggggcttga      8880
     aactgcaagg cgggcgttaa gcgctcagca ggcagcgtta agcactactg caaataacgt      8940
     ggcaaatgcc aatactgatg gttatacaag acagcgggtc tcattggagg caactgacta      9000
     tttccctgct gtatctaaaa atgcagaaaa aacagcggga caaatgggta cgggcgttca      9060
     aggaaaatca gttgagagaa taagagatat ctttcttgac taccaatacc gtcttcaaaa      9120
     caacagtgcc ggatactatg acacgaaggc aaaagcgctg tcccaaatgg aaggcgtttt      9180
     aaatgaaacg gatgacagcg gcttgaacag tgtgctcaat tcgttttgga attccctgca      9240
     ggaattatcg aataatacaa atgaagaaag tgcacgttct gttgttgctc gaaaaggaca      9300
     agctgtagct gaaacgttta attatatttc tgaatcactt acaaatgtcc aatcgaattt      9360
     aaaagcagag ctaaatacaa ctgtgttgga tgtcaattct ctgctttctc agttaaacag      9420
     tttaaataag caaattgcac aagtagagcc ggtcgggctt cttccgaatg gcttatatga      9480
     ccagcgagat ttgctgatcg ataaattatc ctcaatggtt gatatcaaag tcagctacaa      9540
     caaatcaggc gggaatgcac ttgcatctgc tgaaggaact gtatcaattg aaatccttga      9600
     taaaaataaa cagtcgctag gaactgtttt ggacggtaaa aattacgagg tttcagaact      9660
     tgcagccaac tatgataatg aaactgggtt agtatcaagt atttcaatcg gggatacagc      9720
     tgtacaggcg gagtccttta gcagcaaggg atccctttta gggtttatag agtcttatgg      9780
     gtatataaca gcagatggcc aagaaaaggg cgtatacccg gaaatgcttt ctgatcttga      9840
     caatatggcg cttgaattcg cgaaagcttt caatgaagtg cacagaaatg gtgtgaccaa      9900
     gagcggtgaa caaggcggag acttttttga ttttactggc ggtgaaactg aacctgccaa      9960
     gggcgcggcg ggcaagatca aagtggctga cagcataata gattcaaaag gcgcaaacat     10020
     tgctttctca ctgactggcg cagccaacga taacgcaaat gctacaaaat tagcaaatgt     10080
     tttaaccggt aaaataacca ttaacggtaa agaaactagt gttttagatt attatgcggg     10140
     tctgattggc gagctaggga tcgaagctca agaggctaat cgactggcgt ctaatacaga     10200
     aacacagctg aatgatgctg acataaaccg tcagcaaatg agcgcagttt ctttagacga     10260
     agaaatgacg aatatgattc aattccaaca cgcatacaat gcagctgcaa gaatggtgac     10320
     tttacaagac gaattgcttg ataaagtgat caacggcatg ggtgttggag gaaggtaggt     10380
     agagtcacat gagagtaaca caaggcatga tacagcaaaa ctcactgaga tatatcggtt     10440
     caagctactc gaagctggat aaactccagt cgcagatttc ttcaggaaaa aaaatctcaa     10500
     aagcttccga cgatcctgta gtagcaatga aaagcttaaa gtataatacg caactgtctc     10560
     aagtgcagca gtacaaaagc aatgcttctc aagcctttac ctggctcgaa aacacagaaa     10620
     caaacattac agaaggaatt gacatcttgt caaaggtcag agaattagcg gttgaagctc     10680
     aaaatgatac aaacggcgag ccggagcggc aagcgattgg cgtagaggta aagcagttaa     10740
     aggaacagct tttaaatatt gcgaatacac aagtgaacgg cagatatatc tttaatggca     10800
     caaattcaga taagcctccg gttacagata acggagacgg aacttataca atttctgata     10860
     cagctgatgt cgtagtcaat atatcaaata atatgtcatt gaaagtgaat tcagatccaa     10920
     agtcagcttt tggaggcact tctgaaagcg ggcagaatgt atttgaaatg cttgattctt     10980
     ttgagaaagc actaaattct ggttcgctag atggcatgga cagtgtttta aatgatattg     11040
     atcatttttc tgacggcatg agcgctgaac gatctgatct tggagcgaga tataatcgtc     11100
     ttgaactggt taatacaaga ctgtcagcgc aagaagaaac agctaccaaa gtgttatcag     11160
     acaatgaaga tgtagaactg gaagaagtaa taactgaatt tattgcgcag caaagtgtgc     11220
     acagggctac tctggccgtt aatgcgcaaa ttgttcagcc tacattgatt gactttttaa     11280
     agtaagcggc tcttaggagt tcgctttttt tatagttcag gaggtagagt gatgcagatt     11340
     cccagattga ttatgcatag tgttcaagga aaaattggtt taacaacgac gcctgccagc     11400
     ttaaaaatgg agcagcctca agctgatcta gagatcgaac agccgagtgc ggaaatggaa     11460
     atatcggtga cacctggaaa actcacgatt gaccagacac aagcatggga agaattagac     11520
     agaaagcatg ttttcaagag aattgaagaa gccgcccaac aagggcatga ggatgtaatg     11580
     gagggaatag cacgcactgc agaagaaggc gacgagctta tgaagattga aaataagggg     11640
     aacccaatcg cttcacaagc aaggaggaac tctgaaatgc accaaattca attaggcgaa     11700
     aattatgctc cttctctttc gagggtgaaa atacaatata ctccgtcaca gcttgatgtg     11760
     cagattacgc cgcgaaagcc tgttattcag gctgagccgc ataagccaat tgttgaatat     11820
     acgccaggaa atgttaaggt tgacatgctt caataccctg atttaaatat agatgtagaa     11880
     tacccgaaag aatcacccga aaagtaaaaa gaaaaggatc gtgaacaatg atcattcata     11940
     cgaagtacca tggccaaatg aacataaaag aagaacaaat cattcttttt gaaagcggga     12000
     ttccaggctt tttagaagaa aaacagttcg tcatacttcc gctttcagaa gactctccat     12060
     tcgtggcact gcagtccgtc acttcagaaa atcttgcgtt tatcgtcgta agtccgttta     12120
     tcttttttaa gaattatgaa tttgatcttg atgaatcaac tgctgaactt ttggatatcg     12180
     ataatattca agacgtagaa gtcatgacaa tattgactat ggcagagcca tttgaaaagt     12240
     ctactgcgaa tttattggct cccattattg tgaatcgcaa gaacatgatg gctaagcaag     12300
     tcgttttaca cgactcctca tatacgacaa agcatccgat tggaggagaa tcatgctagt     12360
     tttatcgcgg aaaataaacg aagcgattca aataggtgct gatattgaag taaaagtgat     12420
     tgcggttgaa ggggatcaag tgaagcttgg aattgacgcc ccaaagcata ttgatattca     12480
     caggaaagaa atttacttga ccattcagga agaaaataac cgtgcagcag cgttatccag     12540
     cgatgtgatc tccgcattat cctcacaaaa aaagtgagga tttttttatt tttgtattaa     12600
     caaaatcaga gacaatccga tattaatgat gtagccggga ggaggcgcaa aagactcagc     12660
     cagttacaaa ataagggcac aaggacgtgc cttaacaaca tattcaggga ggaacaaaac     12720
     aatgagaatt aaccacaata ttgcagcgct taacacactg aaccgtttgt cttcaaacaa     12780
     cagtgcgagc caaaagaaca tggagaaact ttcttcaggt cttcgcatca accgtgcggg     12840
     agatgacgca gcaggtcttg cgatctctga aaaaatgaga ggacaaatca gaggtcttga     12900
     aatggcttct aaaaactctc aagacggaat ctctcttatc caaacagctg agggtgcatt     12960
     aactgaaact catgcgatcc ttcaacgtgt tcgtgagcta gttgttcaag ctggaaacac     13020
     tggaactcag gacaaagcaa ctgatttgca atctattcaa gatgaaattt cagctttaac     13080
     agatgaaatc gatggtattt caaatcgtac agaattcaat ggtaagaaat tgctcgatgg     13140
     cacttacaaa gttgacacag ctactcctgc aaatcaaaag aacttggtat tccaaatcgg     13200
     agcaaatgct acacagcaaa tctctgtaaa tattgaggat atgggtgctg acgctcttgg     13260
     aattaaagaa gctgatggtt caattgcagc tcttcattca gttaatgatc ttgacgtaac     13320
     aaaattcgca gataatgcag cagatactgc tgatatcggt ttcgatgctc aattgaaagt     13380
     tgttgatgaa gcgatcaacc aagtttcttc tcaacgtgct aagcttggtg cggtacaaaa     13440
     tcgtctagag cacacaatta acaacttaag cgcttctggt gaaaacttga cagctgctga     13500
     gtctcgtatc cgtgacgttg acatggctaa agagatgagc gaattcacaa agaacaacat     13560
     tctttctcag gcttctcaag ctatgcttgc tcaagcaaac caacagccgc aaaacgtact     13620
     tcaattatta cgttaatttt aaaaaagacc ttggcgttgc cagggtcttt taatttaaat     13680
     ttctatctcc taatcattcc tcatcctgtc actaactcat gatataataa ccggattctc     13740
     cactaacttt ttataaatgt atttccatac aagaaatcta aaacagaaga tttttttcca     13800
     aaaatatgtg taatcttatc tcgacttagt cgatataaac gatagattgg ggcatagggg     13860
     atgatcaatt gaacattgaa aggctcacta cgttacaacc tgtttgggat cgttatgata     13920
     ctcaaataca taatcagaaa gataatgata acgaggttcc tgttcatcaa gtttcatata     13980
     ccaatcttgc tgaaatggtg ggggaaatga acaagctttt ggaaccttcg caagttcatc     14040
     tgaagttcga gcttcatgac aagttaaatg aatactatgt aaaggtaata gaggactcta     14100
     caaatgaagt gatccgcgaa attccaccaa aacggtggct tgatttttat gcggctatga     14160
     ctgaatttct tgggttattt gtagatgaaa aaaagtagaa taggagtggt ttgagatggt     14220
     cacaagaata acaggtctgg cgtcaggaat ggatatagat gatatcgtat caaagctgat     14280
     gcagacagaa agagcgccgc ttgataagct gacacaaaaa aagcagactc ttgaatggca     14340
     gcgtgacagc tatcgtgaag taaactcaaa aataaaagaa ttgcaagatt atatgtctaa     14400
     aaatacgttg acatatccga gcacgtatca gagcaaaact gtgacaagct ctaatgagtc     14460
     tgtgttaact gctacaggaa gcgtaagtgc gccaaattct tcgtctactg ttgaagtggc     14520
     gagcttggca actgcagcaa cgtataaggc aaacaattat acgggataca cacaaggcga     14580
     ttacaatttg gcatttaacg ttgttgcgcc tggcgaaaca acagcaaaaa cagtgaacat     14640
     tagtgtgacg agtgccgata cgattgataa tgtgatttct aaacttaaca gctcagatct     14700
     aggagtatca gcatttaaag ataaaatttg gaatggtaca gagtacgtag aaacgattgc     14760
     gttttcttct aaagcaacag gtgcaggagg aagcatacag gcagcagact ctgctacagc     14820
     tgactttatg tccggtcagc ttggtttttc tttggatgct gataataagc ttactgctta     14880
     caaagaaggc acaaatgcca aagtcacaat caacggcttt gaaatggaga agctgacaaa     14940
     caatttcacg gtgaatggtg ttacttattc gattaaaaat acaactgcag ccacaggccc     15000
     tgttaccaca tctgtttcta ctgatgttga tgggatttat aaccaaatca aagagtttgt     15060
     agataaatac aatgaactgg ttgacagcct gaatgaaaag ctgaaagaag aaaaataccg     15120
     agactatacg ccactcacga gtgaacaaaa agaagccatg tccgataaag aggtagagct     15180
     ctgggaggag aaggcgaaaa gcggattgct gagaaacgat tcaagcatca gcactggcac     15240
     gaaccaaatg cggactgact tttatactca agtgaatgcg gatgggaaaa cctatcaatt     15300
     aactgaattt ggcatcacaa cttcaagtgc ttaccaactg cgagggcact tagagattaa     15360
     cgaagagaaa ttgaaagcaa aaatagcaga agatcctcaa ggagttgcta atctttttac     15420
     aagtggaaca aatgatagta actatagcga taaaggtatt atgaagcgga ttactaatac     15480
     acttagaagt actgtgaaaa gtattgaagc taaagctggg aactcgacaa tgggagctag     15540
     tagctattcc attggaaaaa atttaaactc gataagtact gaaataactg atatgcagga     15600
     cagattgaat accatagaaa accgctatta ttcaaaattc agtgcaatgg attctgcgat     15660
     tcaaaaaatg aacgaacaag cgtcctattt atcacagctt cttgtacaat aaatgtaatt     15720
     tggaggatga cacatggcga tccaaaatcc atatacagcc tatcagcaaa attcagtgaa     15780
     tacggctaca cccggggagc tgacgcttat gctgtataat ggctgtttga aatttataag     15840
     acttgccgct caggccattg agaatgatga tatggaacgt aaaaatgaaa atctgattaa     15900
     agcgcaaaat attattcagg aattaaattt tacacttaac cgtaacatag agctttccgc     15960
     ttctatgggt gcgatgtacg attatatgta tcgcagattg gtacaggcaa atatcaaaaa     16020
     tgatacgggc atgctggctg aggttgaagg ttatgtaaca gattttcgcg atgcttggaa     16080
     acaagccatt caaagtgagc ggaaggaccg gcacggatca ggcgggatcg catgaataat     16140
     atagatcaac tatacactga gacgaagagt atgctgtcac acatacaaaa tacgccggaa     16200
     agcgatgaac ttttaaagca aattgaagac tttgtggcta cacggtctga actgattcag     16260
     gagatatctc tgccgctttc agaagaagag cgaaagcaga tgaaacttat tttgacatgg     16320
     gatcagctga ttgtgaagga aatggaaaga ctgaagcagt caatcgcaac agaacttcag     16380
     cagatgaaaa gaaaacgtgt gatgcatacg acgtatttaa acccttataa caacattacg     16440
     attgacggca catattatga caagcgtaaa taggtgagtg ccttgaagag cattgaagat     16500
     tatacgcttt tatcagctta ttatcatctt ctttttacca tcgaagaggg gttgtgttat     16560
     ttgatagagg ctgaagagaa tttatcaaaa acagaagggg atcggatcta ccaagatctg     16620
     atccaagcct ttttttattt ggattcaaca cattcaacac ttctcttcat tatggattcg     16680
     cggtgtgctg aaatttgtgt gaaagcattt gaccaaattt ttgcggagtt tgatcaattg     16740
     gtctctttct cttttccctc tcatgagttc tgtgagtatt taaaggaaca ttttctgatt     16800
     cattatagaa aatggatgct gtctattcat caatgtatgg aacccttttt aatcaattag     16860
     gcgtgtgtga ggtatttgtt tcgttcaatc agcatataca tatacctccg aaccgccaat     16920
     aacagagcaa atacaaacaa aattcgacaa agttcactga attttcacaa aagatttatg     16980
     tttcagcagg aattgtaaag ggtaaaagag aaatagatac atatccttaa taaaagggag     17040
     gcgttctttg atgaactata acatcagagg agaaaatatt gaagtgacac ccgcgttaaa     17100
     ggatcatgtc gagaggaaga tcggcaagct ggagcgctat tttgaccata gcgtggatgc     17160
     tgatgtgaac gtcaacttga agttttacaa tgacaaggag tctaaggttg aggttacgat     17220
     tccgatgaca gatctggcgc ttcggtccga ggtgcataac gaggatatgt acaacgcaat     17280
     tgatctcgca acaaacaaac tggaacgtca aatccgtaag cataaaacga aagtaaaccg     17340
     taaattccgt gagcagggct ctccaaaata tttattggca aacggtcttg gctctgatac     17400
     agatattgcg gttcaggatg acatagaaga ggaggagagc ttggacatcg tccgtcagaa     17460
     acgctttaat ttaaagccga tggatagtga agaagcgatc ttgcaaatga atatgctcgg     17520
     ccataatttc tttgttttca caaatgcgga aacaaacctt acaaatgtcg tgtaccgcag     17580
     aaatgacggg aaatatggct taattgaacc gactgaataa tgaagagaag ccttccgtga     17640
     tgtccgcgga aggtttttgt ttttcttatt tgcaaattct ttggaaataa caaaaggtat     17700
     gatatgataa tgagaggtat acatggacta gtaaattatt tatacatgcc tctaaaatag     17760
     gcgtgtgatg atagaggagc gttataaatg cttggaattt taaataaaat gtttgatcca     17820
     acaaaacgta cgctgaatag atacgaaaaa attgctaacg atattgatgc gattcgcgga     17880
     gactatgaaa atctctctga cgacgcattg aaacataaaa caattgaatt taaagagcgt     17940
     cttgaaaaag gggcgacaac ggatgatctt cttgttgaag ctttcgctgt tgttcgagaa     18000
     gcttcacgcc gcgtaacagg catgtttccg tttaaagtcc agctcatggg gggcgtggcg     18060
     cttcatgacg gaaatatagc ggaaatgaaa acaggggaag ggaaaacatt aacgtctacc     18120
     ctgcctgttt atttaaatgc gttaaccggt aaaggcgtac acgtcgtgac tgtcaacgaa     18180
     tacttggcaa gccgtgacgc tgagcaaatg gggaaaattt tcgagtttct cggtttgact     18240
     gtcggtttga atttaaactc aatgtcaaaa gacgaaaaac gggaagctta tgccgctgat     18300
     attacttact ccacaaacaa cgagcttggc ttcgactatt tgcgtgacaa tatggttctt     18360
     tataaagagc agatggttca gcgcccgctt cattttgcgg taatagatga agttgactct     18420
     attttaattg atgaagcaag aacaccgctt atcatttctg gacaagctgc aaaatccact     18480
     aagctgtacg tacaggcaaa tgcttttgtc cgcacgttaa aagcggagaa ggattacacg     18540
     tacgatatca aaacaaaagc tgtacagctt actgaagaag gaatgacgaa ggcggaaaaa     18600
     gcattcggca tcgataacct ctttgatgtg aagcatgtcg cgctcaacca ccatatcaac     18660
     caggccttaa aagctcacgt tgcgatgcaa aaggacgttg actatgtagt ggaagacgga     18720
     caggttgtta ttgttgattc cttcacggga cgtctgatga aaggccgccg ctacagtgag     18780
     gggcttcacc aagcgattga agcaaaggaa gggcttgaga ttcaaaacga aagcatgacc     18840
     ttggcgacga ttacgttcca aaactacttc cgaatgtacg aaaaacttgc cggtatgacg     18900
     ggtacagcta agacagagga agaagaattc cgcaacatct acaacatgca ggttgtcacg     18960
     atccctacca acaggcctgt tgtccgtgat gaccgcccgg atttaattta ccgcacgatg     19020
     gaaggaaagt ttaaggcagt tgcggaggat gtcgcacagc gttacatgac gggacagcct     19080
     gttctagtcg gtacggttgc cgttgaaaca tctgaattga tttctaagct gcttaaaaac     19140
     aaaggaattc cgcatcaagt gttaaatgcc aaaaaccatg aacgtgaagc gcagatcatt     19200
     gaagaggccg gccaaaaagg cgcagttacg attgcgacta acatggcggg gcgcggaacg     19260
     gacattaagc ttggcgaagg tgtaaaagag cttggcgggc tcgctgtagt cggaacagaa     19320
     cgacatgaat cacgccggat tgacaatcag cttcgaggtc gttccggacg tcagggagac     19380
     ccggggatta ctcaatttta tctttctatg gaagatgaat tgatgcgcag attcggagct     19440
     gagcggacaa tggcgatgct tgaccgcttc ggcatggacg actctactcc aatccaaagc     19500
     aaaatggtat ctcgcgcggt tgaatcgtct caaaaacgcg tcgaaggcaa taacttcgat     19560
     tcgcgtaaac agcttctgca atatgatgat gttctccgcc agcagcgtga ggtcatttat     19620
     aagcagcgct ttgaagtcat tgactctgaa aacctgcgtg aaatcgttga aaatatgatc     19680
     aagtcttctc tcgaacgcgc aattgcagcc tatacgccaa gagaagagct tcctgaggag     19740
     tggaagcttg acggtctagt tgatcttatc aacacaactt atcttgatga aggtgcactt     19800
     gagaagagcg atatcttcgg caaagaaccg gatgaaatgc ttgagctcat tatggatcgc     19860
     atcatcacaa aatataatga gaaggaagag caattcggca aagagcaaat gcgcgaattc     19920
     gaaaaagtta tcgttcttcg tgccgttgat tctaaatgga tggatcatat tgatgcgatg     19980
     gatcagctcc gccaagggat tcaccttcgt gcttacgcgc agacgaaccc gcttcgtgag     20040
     tatcaaatgg aaggttttgc gatgtttgag catatgattg aatcaattga ggacgaagtc     20100
     gcaaaatttg tgatgaaagc tgagattgaa aacaatctgg agcgtgaaga ggttgtacaa     20160
     ggtcaaacaa cagctcatca gccgcaagaa ggcgacgata acaaaaaagc aaagaaagca     20220
     ccggttcgca aagtggttga tatcggacga aatgccccat gccactgcgg aagcgggaaa     20280
     aaatataaaa attgctgcgg ccgtactgaa tagttcgccc                           20320
//

If you have problems or comments...

PBIL Back to PBIL home page