(data stored in ACNUC16935 zone)

EMBL: U57603

ID   U57603; SV 1; linear; mRNA; STD; VRT; 352 BP.
XX
AC   U57603;
XX
DT   19-JAN-1997 (Rel. 50, Created)
DT   27-JUN-2018 (Rel. 137, Last updated, Version 6)
XX
DE   Gallus gallus polyubiquitin (UbI) mRNA, partial cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-352
RX   DOI; 10.1002/(SICI)1098-2795(199704)46:4<471::AID-MRD4>3.0.CO;2-L.
RX   PUBMED; 9094093.
RA   Mezquita J., Pau M., Mezquita C.;
RT   "Heat-shock inducible polyubiquitin gene UbI undergoes alternative
RT   initiation and alternative splicing in mature chicken testes";
RL   Mol. Reprod. Dev. 46(4):471-475(1997).
XX
RN   [2]
RP   1-352
RA   Mezquita J., Pau M., Mezquita C.;
RT   ;
RL   Submitted (06-MAY-1996) to the INSDC.
RL   J. Mezquita, Molecular Genetics Research Group, Faculty of Medicine,
RL   University of Barcelona, Casanova 143, Barcelona 08034, Spain
XX
DR   MD5; a93c423bdc2e1332b1c3e3db8feddfaf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..352
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="mature testes"
FT                   /db_xref="taxon:9031"
FT   gene            1..352
FT                   /gene="UbI"
FT   misc_feature    73..78
FT                   /gene="UbI"
FT                   /note="CTCTCT element"
FT   misc_feature    129..134
FT                   /gene="UbI"
FT                   /note="AGAGAG element"
FT   misc_feature    134..135
FT                   /gene="UbI"
FT                   /note="position of 5' intron"
FT   CDS_pept        141..>352
FT                   /codon_start=1
FT                   /gene="UbI"
FT                   /product="polyubiquitin"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:1YIW"
FT                   /db_xref="PDB:2FCQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q9PST8"
FT                   /protein_id="AAB39514.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVL"
XX
SQ   Sequence 352 BP; 95 A; 86 C; 92 G; 79 T; 0 other;
     ggagtagccg tttcaccgca actccagatc catccgcacc ctcagaaatt ttggggttat        60
     taagggtctc agctctctgc cgaagatatc agggacccct ttgctcctgg aagagggatt       120
     ggagaggtag agaggtaaac atgcagatct ttgtgaagac cctgactggc aagaccatca       180
     cccttgaggt tgagcccagt gacaccattg agaatgtgaa ggccaagatc caagacaagg       240
     aaggcattcc tcctgatcag cagaggttga tctttgctgg gaagcagctg gaagatggcc       300
     gcacgctgtc tgactacaat atccagaaag aatcaactct tcaccttgtg ct               352
//

If you have problems or comments...

PBIL Back to PBIL home page