(data stored in ACNUC8465 zone)

EMBL: U66839

ID   U66839; SV 2; linear; mRNA; STD; HUM; 1870 BP.
XX
AC   U66839;
XX
DT   21-JAN-1997 (Rel. 50, Created)
DT   26-DEC-2016 (Rel. 131, Last updated, Version 5)
XX
DE   Homo sapiens MAP kinase 3b mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1870
RA   Han J.;
RT   ;
RL   Submitted (13-AUG-1996) to the INSDC.
RL   Immunology, The Scripps Research Institute, 10666 N. Torrey Pines Road, La
RL   Jolla, CA 92037, USA
XX
RN   [2]
RC   Sequence update by database staff to remove vector contamination
RP   1-1870
RA   Hellrung D.J., Tatum F.M., Briggs R.E.;
RT   ;
RL   Submitted (23-DEC-2016) to the INSDC.
RL   RDNRU, National Animal Disease Center, Agricultural Research Service,
RL   United States Department of Agriculture, 2300 Dayton Ave., Ames, IA 50010,
RL   USA
XX
DR   MD5; 4d0859f98fcb56e17ff626a41a63444e.
DR   Ensembl-Gn; ENSG00000034152; homo_sapiens.
DR   Ensembl-Tr; ENST00000316920; homo_sapiens.
DR   Ensembl-Tr; ENST00000342679; homo_sapiens.
DR   Ensembl-Tr; ENST00000361818; homo_sapiens.
DR   Ensembl-Tr; ENST00000613338; homo_sapiens.
XX
CC   On Dec 23, 2016 this sequence version replaced gi:1778152.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1870
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        91..1134
FT                   /codon_start=1
FT                   /product="MAP kinase 3b"
FT                   /note="protein kinase"
FT                   /db_xref="GOA:P46734"
FT                   /db_xref="H-InvDB:HIT000220994.15"
FT                   /db_xref="HGNC:HGNC:6843"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46734"
FT                   /protein_id="AAB40652.1"
FT                   /translation="MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLD
FT                   SRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQ
FT                   KRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPE
FT                   DILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKT
FT                   MDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQV
FT                   VEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVK
FT                   KILGEDS"
XX
SQ   Sequence 1870 BP; 381 A; 574 C; 524 G; 391 T; 0 other;
     gtctgcccgc agccatgagc gtgctcggcc ccggtggagc ccgcagtcct ctagattagt        60
     ctccaccgcc gtccaggacc cacttgcagc atggagtcgc ccgcctcgag ccagcccgcc       120
     agcatgcccc agtccaaagg aaaatccaag aggaagaagg atctacggat atcctgcatg       180
     tccaagccac ccgcacccaa ccccacaccc ccccggaacc tggactcccg gaccttcatc       240
     accattggag acagaaactt tgaggtggag gctgatgact tggtgaccat ctcagaactg       300
     ggccgtggag cctatggggt ggtagagaag gtgcggcacg cccagagcgg caccatcatg       360
     gccgtgaagc ggatccgggc caccgtgaac tcacaggagc agaagcggct gctcatggac       420
     ctggacatca acatgcgcac ggtcgactgt ttctacactg tcaccttcta cggggcacta       480
     ttcagagagg gagacgtgtg gatctgcatg gagctcatgg acacatcctt ggacaagttc       540
     taccggaagg tgctggataa aaacatgaca attccagagg acatccttgg ggagattgct       600
     gtgtctatcg tgcgggccct ggagcatctg cacagcaagc tgtcggtgat ccacagagat       660
     gtgaagccct ccaatgtcct tatcaacaag gagggccatg tgaagatgtg tgactttggc       720
     atcagtggct acttggtgga ctctgtggcc aagacgatgg atgccggctg caagccctac       780
     atggcccctg agaggatcaa cccagagctg aaccagaagg gctacaatgt caagtccgac       840
     gtctggagcc tgggcatcac catgattgag atggccatcc tgcggttccc ttacgagtcc       900
     tgggggaccc cgttccagca gctgaagcag gtggtggagg agccgtcccc ccagctccca       960
     gccgaccgtt tctcccccga gtttgtggac ttcactgctc agtgcctgag gaagaacccc      1020
     gcagagcgta tgagctacct ggagctgatg gagcacccct tcttcacctt gcacaaaacc      1080
     aagaagacgg acattgctgc cttcgtgaag aagatcctgg gagaagactc ataggggctg      1140
     ggcctcggac cccactccgg ccctccagag ccccacagcc ccatctgcgg gggcagtgct      1200
     cacccacacc ataagctact gccatcctgg cccagggcat ctgggaggaa ccgagggggc      1260
     tgctcccacc tggctctgtg gcgagccatt tgtcccaagt gccaaagaag cagaccattg      1320
     gggctcccag ccaggccctt gtcggcccca ccagtgcctc tccctgctgc tcctaggacc      1380
     cgtctccagc tgctgagatc ctggactgag ggggcctgga tgccccctgt ggatgctgct      1440
     gcccctgcac agcaggctgc cagtgcctgg gtggatgggc caccgccttg cccagcctgg      1500
     atgccatcca agttgtatat ttttttaatc tctcgactga atggactttg cacactttgg      1560
     cccagggtgg ccacacctct atcccggctt tggtgcgggg tacacaagag gggatgagtt      1620
     gtgtgaatac cccaagactc ccatgaggga gatgccatga gccgcccaag gccttcccct      1680
     ggcactggca aacagggcct ctgcggagca cactggctca cccagtcctg cccgccaccg      1740
     ttatcggtgt cattcacctt tcgtgttttt tttaatttat cctctgttga ttttttcttt      1800
     tgctttatgg gtttggcttg tttttcttgc atggtttgga gctgatcgct tctcccccac      1860
     cccctagggg                                                             1870
//

If you have problems or comments...

PBIL Back to PBIL home page