(data stored in ACNUC8465 zone)

EMBL: U66840

ID   U66840; SV 1; linear; genomic DNA; STD; HUM; 2166 BP.
XX
AC   U66840;
XX
DT   21-JAN-1997 (Rel. 50, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Human MAP kinase 3c gene, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2166
RA   Han Jiahuai.;
RT   ;
RL   Submitted (13-AUG-1996) to the INSDC.
RL   Immunology, The Scripps Research Institute, 10666 N. Torrey Pines Road, La
RL   Jolla, CA 92037, USA
XX
DR   MD5; a776a3b2649718c0d6007d204d801916.
DR   Ensembl-Gn; ENSG00000034152; homo_sapiens.
DR   Ensembl-Tr; ENST00000316920; homo_sapiens.
DR   Ensembl-Tr; ENST00000342679; homo_sapiens.
DR   Ensembl-Tr; ENST00000361818; homo_sapiens.
DR   Ensembl-Tr; ENST00000613338; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2166
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        372..1430
FT                   /codon_start=1
FT                   /product="MAP kinase 3c"
FT                   /note="protein kinase"
FT                   /db_xref="GOA:P46734"
FT                   /db_xref="HGNC:HGNC:6843"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46734"
FT                   /protein_id="AAB40653.1"
FT                   /translation="MGVQGTLMSRDSQTPHLLSILGKSKRKKDLRISCMSKPPAPNPTP
FT                   PRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATV
FT                   NSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKN
FT                   MTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVD
FT                   SVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQ
FT                   QLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDI
FT                   AAFVKKILGEDS"
XX
SQ   Sequence 2166 BP; 434 A; 644 C; 630 G; 458 T; 0 other;
     actcataggg ctcgagcggg cgccgggggg tcagctatga agcccctcta cagtggctgc        60
     tgcaggtgct ggctggaccc cgctgggccc cttctcaccc cacatcccat tgattgatta       120
     gtcaggcagg gcagtgagga cacctcacag atggggaaac tgaagcccag ggaggtactc       180
     aagatgtgcc cagtgcgggc tgagataagg ccctggagtc cacctccagg ctgggtctgt       240
     cctgctctgc tccctgcagg gctggtgggc ctccttcccc cttttgacta acggcctggc       300
     ttggagagag ggggctcccg gcatgggtga tggcagaggc tggcaccctt gtggccaggg       360
     cctgatggct catgggagtg caggggacat tgatgtcaag ggatagccag acgcctcacc       420
     ttctctccat tctaggaaaa tccaagagga agaaggatct acggatatcc tgcatgtcca       480
     agccacccgc acccaacccc acaccccccc ggaacctgga ctcccggacc ttcatcacca       540
     ttggagacag aaactttgag gtggaggctg atgacttggt gaccatctca gaactgggcc       600
     gtggagccta tggggtggta gagaaggtgc ggcacgccca gagcggcacc atcatggccg       660
     tgaagcggat ccgggccacc gtgaactcac aggagcagaa gcggctgctc atggacctgg       720
     acatcaacat gcgcacggtc gactgtttct acactgtcac cttctacggg gcactattca       780
     gagagggaga cgtgtggatc tgcatggagc tcatggacac atccttggac aagttctacc       840
     ggaaggtgct ggataaaaac atgacaattc cagaggacat ccttggggag attgctgtgt       900
     ctatcgtgcg ggccctggag catctgcaca gcaagctgtc ggtgatccac agagatgtga       960
     agccctccaa tgtccttatc aacaaggagg gccatgtgaa gatgtgtgac tttggcatca      1020
     gtggctactt ggtggactct gtggccaaga cgatggatgc cggctgcaag ccctacatgg      1080
     cccctgagag gatcaaccca gagctgaacc agaagggcta caatgtcaag tccgacgtct      1140
     ggagcctggg catcaccatg attgagatgg ccatcctgcg gttcccttac gagtcctggg      1200
     ggaccccgtt ccagcagctg aagcaggtgg tggaggagcc gtccccccag ctcccagccg      1260
     accgtttctc ccccgagttt gtggacttca ctgctcagtg cctgaggaag aaccccgcag      1320
     agcgtatgag ctacctggag ctgatggagc accccttctt caccttgcac aaaaccaaga      1380
     agacggacat tgctgccttc gtgaagaaga tcctgggaga agactcatag gggctgggcc      1440
     tcggacccca ctccggccct ccagagcccc acagccccat ctgcgggggc agtgctcacc      1500
     cacaccataa gctactgcca tcctggccca gggcatctgg gaggaaccga gggggctgct      1560
     cccacctggc tctgtggcga gccatttgtc ccaagtgcca aagaagcaga ccattggggc      1620
     tcccagccag gcccttgtcg gccccaccag tgcctctccc tgctgctcct aggacccgtc      1680
     tccagctgct gagatcctgg actgaggggg cctggatgcc ccctgtggat gctgctgccc      1740
     ctgcacagca ggctgccagt gcctgggtgg atgggccacc gccttgccca gcctggatgc      1800
     catccaagtt gtatattttt ttaatctctc gactgaatgg actttgcaca ctttggccca      1860
     gggtggccac acctctatcc cggctttggt gcggggtaca caagagggga tgagttgtgt      1920
     gaatacccca agactcccat gagggagatg ccatgagccg cccaaggcct tcccctggca      1980
     ctggcaaaca gggcctctgc ggagcacact ggctcaccca gtcctgcccg ccaccgttat      2040
     cggtgtcatt cacctttcgt gtttttttta atttatcctc tgttgatttt ttcttttgct      2100
     ttatgggttt ggcttgtttt tcttgcatgg tttggagctg atcgcttctc ccccaccccc      2160
     tagggg                                                                 2166
//

If you have problems or comments...

PBIL Back to PBIL home page