(data stored in ACNUC16935 zone)

EMBL: U67931

ID   U67931; SV 1; linear; mRNA; STD; VRT; 546 BP.
XX
AC   U67931;
XX
DT   19-JAN-1997 (Rel. 50, Created)
DT   27-JUN-2018 (Rel. 137, Last updated, Version 4)
XX
DE   Gallus gallus ubiquitin/ribosomal protein mRNA, complete cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-546
RX   DOI; 10.1016/S0378-1119(97)00189-3.
RX   PUBMED; 9305777.
RA   Mezquita J., Pau M., Mezquita C.;
RT   "Characterization and expression of two chicken cDNAs encoding ubiquitin
RT   fused to ribosomal proteins of 52 and 80 amino acids";
RL   Gene 195(2):313-319(1997).
XX
RN   [2]
RP   1-546
RA   Mezquita J., Pau M., Mezquita C.;
RT   ;
RL   Submitted (26-AUG-1996) to the INSDC.
RL   Molecular Genetics Research Group, Faculty of Medicine. University of
RL   Barcelona, Casanova 143, Barcelona 08036, Spain
XX
DR   MD5; cde89379b05a00f1cb2637401d506a25.
DR   Ensembl-Gn; ENSGALG00000036790; gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000059625; gallus_gallus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Gallus gallus"
FT                   /strain="Hubbard White Mountain"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="testis and kidney"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        39..509
FT                   /codon_start=1
FT                   /product="ubiquitin/ribosomal protein"
FT                   /note="ubiquitin fused to ribosomal protein"
FT                   /db_xref="GOA:P79781"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79781"
FT                   /protein_id="AAC60279.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLK
FT                   YYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK"
XX
SQ   Sequence 546 BP; 159 A; 129 C; 141 G; 117 T; 0 other;
     cccttcaccg cctctccccc gcgggtgccg gcctcgacat gcagatcttc gtgaagaccc        60
     ttacggggaa gaccatcacc ctcgaggttg agccctccga tactatagaa aatgtgaaag       120
     ctaagattca ggataaggaa ggaattcctc ctgatcagca gcgactgatt tttgctggga       180
     agcagctgga agatggccgc acgctgtctg actacaatat ccagaaagaa tcaactcttc       240
     accttgtgct gagactgcgt ggtggtgcta agaaaagaaa gaagaagtct tacaccaccc       300
     ccaagaagaa caagcataag aggaagaagg ttaaacttgc cgtgctgaag tactacaagg       360
     tggatgagaa cggcaagatc agtcgtctgc gccgagagtg cccctctgag gagtgtgggg       420
     cgggagtctt catggctagc cacttcgaca gacactattg tggcaagtgt tgtctgacat       480
     actgcttcaa taagcctgaa gacaagtaaa tgtactagac aataaaaatc tgaagttctg       540
     tactga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page