(data stored in SCRATCH zone)

EMBL: U68235

ID   U68235; SV 1; linear; genomic DNA; STD; PRO; 2615 BP.
XX
AC   U68235;
XX
DT   23-SEP-1996 (Rel. 49, Created)
DT   24-JUN-2016 (Rel. 129, Last updated, Version 4)
XX
DE   Bacillus subtilis recombination protein (recN) and sporulation protein
DE   SpoOA genes, partial cds and sporulation protein spoIVB gene, complete cds.
XX
KW   .
XX
OS   Bacillus subtilis subsp. subtilis str. JH642
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-2615
RX   DOI; 10.1046/j.1365-2958.1997.2091573.x.
RX   PUBMED; 9044256.
RA   Oke V., Shchepetov M., Cutting S.;
RT   "SpoIVB has two distinct functions during spore formation in Bacillus
RT   subtilis";
RL   Mol. Microbiol. 23(2):223-230(1997).
XX
RN   [2]
RP   1-2615
RA   Oke V.;
RT   ;
RL   Submitted (28-AUG-1996) to the INSDC.
RL   Biological Sciences, Stanford Univ., Stanford, CA 94305-5020, USA
XX
DR   MD5; c7f80d1d028db5db6bcc0f13eb704939.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2615
FT                   /organism="Bacillus subtilis subsp. subtilis str. JH642"
FT                   /map="218 degrees"
FT                   /sub_species="subtilis"
FT                   /strain="JH642"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:535025"
FT   gene            <1..697
FT                   /gene="recN"
FT   CDS_pept        <1..697
FT                   /codon_start=2
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /product="RecN"
FT                   /note="recombination protein"
FT                   /db_xref="GOA:P17894"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17894"
FT                   /protein_id="AAC44870.1"
FT                   /translation="SLKKELDSVGKDVAVEAANVSQIRKTWAKKLADEIHRELKSLYME
FT                   KSTFDTEFKVRTASRNEEAPLVNGQPVQLTEQGIDLVKFLISTNTGEPLKSLSKVASGG
FT                   ELSRVMLAIKSIFSSQQDVTSIIFDEVDTGVSGRVAQAIAEKIHKVSIGSQVLCITHLP
FT                   QVAAMADTHLYIAKELKDGRTTTRVKPLSKQEKVAEIGRMIAGVEVTDLTKRHAKELLK
FT                   QADQVKTTG"
FT   CDS_pept        872..2152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="SpoIVB"
FT                   /note="sporulation protein"
FT                   /db_xref="GOA:P71028"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR014219"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:P71028"
FT                   /protein_id="AAC44871.1"
FT                   /translation="MPDNIRKAVGLILLVSLLSVGLCKPLKEYLLIPTQMRVFETQTQA
FT                   IETSLSVNAQTSESSEAFTVKKDPHEIKVTGKKSGESELVYDLAGFPIKKTKVHVLPDL
FT                   KVIPGGQSIGVKLHSVGVLVVGFHQINTSEGKKSPGETAGIEAGDIIIEMNGQKIEKMN
FT                   DVAPFIQKAGKTGESLDLLIKRDKQKIKTKLIPEKDEGEGKYRIGLYIRDSAAGIGTMT
FT                   FYEPKTKKYGALGHVISDMDTKKPIVVENGEIVKSTVTSIEKGTGGNPGEKLARFSSER
FT                   KTIGDINRNSPFGIFGTLHQPIQNNISDQALPVAFSTEVKKGPAEILTVIDDDKVEKFD
FT                   IEIVSTTPQKFPATKGMVLKITDPRLLKETGGIVQGMSGSPIIQNGKVIGAVTHVFVND
FT                   PTSGYGVHIEWMLSEAGIDIYGKEKAS"
FT   CDS_pept        2428..>2615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="SpoOA"
FT                   /note="sporulation protein"
FT                   /db_xref="GOA:P06534"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012052"
FT                   /db_xref="InterPro:IPR014879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="PDB:1LQ1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06534"
FT                   /protein_id="AAC44872.1"
FT                   /translation="MEKIKVCVADDNRELVSLLSEYIEGQEDMEVIGVAYNGQECLSLF
FT                   KEKDPDVLVLDIIMPHL"
XX
SQ   Sequence 2615 BP; 886 A; 470 C; 622 G; 637 T; 0 other;
     aagcttgaaa aaggagcttg actccgtcgg caaagatgtc gcagtggaag cggcaaatgt        60
     gtcacaaatc cgaaaaacat gggcgaaaaa gctggctgat gagattcatc gggaattaaa       120
     aagcctgtac atggaaaaat caacttttga tacggaattt aaggtcagaa cagcgtcacg       180
     caatgaagag gcgccgcttg taaacggcca gcccgttcag ctgactgaac aagggattga       240
     cctggtgaag tttttaattt caaccaatac aggcgagccg ctgaaatccc tttcgaaagt       300
     cgcttcaggt ggagagctgt cacgggtgat gcttgccata aaaagcattt tttcctcaca       360
     acaggatgtg acatcgatca tttttgacga ggttgatacc ggtgtaagcg gcagggtcgc       420
     acaggcaatt gctgagaaga tccataaggt gtcaatagga tcacaagtgc tgtgcattac       480
     acacctgcct caggtggctg ccatggccga tacgcatctt tatattgcga aggagttaaa       540
     agacggcaga acgacgacac gtgtcaagcc gctctctaag caggaaaagg tagcggaaat       600
     cgggcgcatg attgcaggtg tcgaagtaac cgacttaacg aaacgccatg cgaaagaact       660
     tttaaaacaa gcggatcaag tcaaaacaac tgggtaagct gcgcgagaag cgcagcttat       720
     ttttttcgtg cacatccatt cgttcatcag tatatccaat gtttttcttc atatgacagt       780
     tataaataag ccgtcagaag gcaaaattaa atgatgtagc agcaagtcat aaagaaggtg       840
     tgggatagga gcgaggagag tgaagtagtg aatgcccgat aacatcagaa aagcagtagg       900
     tttaattctc cttgtttcgt tattaagtgt aggtttatgc aaaccgctaa aagaatattt       960
     actgattcca acgcaaatga gagtatttga aacccaaaca caagcgattg aaacgagttt      1020
     atcggtaaac gctcagacat cagaatcctc agaagcgttt acagtaaaga aagatccgca      1080
     tgaaatcaag gtgacgggca aaaaatcagg tgagtcagaa ttggtatatg atcttgccgg      1140
     atttccaatt aaaaaaacaa aagtgcatgt tcttcctgat ttaaaagtta tacctggcgg      1200
     acaatcaatc ggtgtaaaac ttcattccgt cggtgttctt gtcgtcggat ttcatcaaat      1260
     caatacaagt gaaggcaaaa aatctccggg agaaacggca ggaattgaag cgggcgacat      1320
     cattattgag atgaatggac agaaaattga aaaaatgaat gatgtagccc catttattca      1380
     aaaggctggg aaaactggtg aatctttaga cttactgatc aaacgtgata aacagaaaat      1440
     caaaacgaag ctgatcccag aaaaggatga aggagaaggc aaatacagaa tcgggttata      1500
     tatcagagat tctgctgctg gcatcggcac tatgaccttt tatgaaccga aaacaaaaaa      1560
     atacggagca cttggccacg tgatttccga tatggacaca aagaaaccaa ttgtagtgga      1620
     gaatggagaa atcgttaaat ccactgtaac atcaattgaa aaagggacag gcggtaatcc      1680
     gggagaaaaa ctggcgcgat tttcctcaga acgcaaaacg atcggggata ttaacagaaa      1740
     cagcccgttt gggattttcg gcacactgca tcagccgatt caaaacaaca tatcagatca      1800
     agcattgccg gttgcgtttt ctaccgaagt caaaaaaggg ccggctgaaa ttttaacggt      1860
     tattgatgat gacaaagtag aaaaattcga tattgaaatc gtcagcacaa cgccgcaaaa      1920
     attccctgcg acaaaaggaa tggtgttgaa aattaccgat ccaagactgt tgaaagaaac      1980
     aggaggcatc gtacagggga tgagcggaag cccgatcatt caaaatggaa aagtgatcgg      2040
     tgctgtcacc catgtatttg taaatgaccc gacaagcggc tacggtgttc atattgaatg      2100
     gatgctgtca gaagcaggaa tcgatattta tggaaaagaa aaagcaagct gactgccgga      2160
     gtttccggca gtttttttat tttgatccct cttcacttct cagaatacat acggtaaaat      2220
     atacaaaaga agatttttcg acaaattcac gtttccttgt ttgtcaaatt tcatttttag      2280
     tcgaaaaaca gagaaaaaca tagaataaca aagatatgcc actaatattg gtgattatga      2340
     tttttttaga gggtatatag cggttttgtc gaatgtaaac atgtagcaag ggtgaatcct      2400
     gttaactaca tttggggagg aagaaacgtg gagaaaatta aagtttgtgt tgctgatgat      2460
     aatcgagagc tggtaagcct gttaagtgaa tatatagaag gacaggaaga catggaagtg      2520
     atcggcgttg cttataacgg acaggaatgc ctgtcgctgt ttaaagaaaa agatcccgat      2580
     gtgctcgtat tagatattat tatgccgcat ctaga                                 2615
//

If you have problems or comments...

PBIL Back to PBIL home page