(data stored in ACNUC9552 zone)

EMBL: U72349

ID   U72349; SV 1; linear; mRNA; STD; ROD; 1748 BP.
XX
AC   U72349;
XX
DT   29-OCT-1996 (Rel. 49, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Rattus norvegicus Bcl-xbeta mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1748
RX   DOI; 10.1074/jbc.271.22.13258.
RX   PUBMED; 8662675.
RA   Shiraiwa N., Inohara N., Okada S., Yuzaki M., Shoji S., Ohta S.;
RT   "An additional form of rat Bcl-x, Bcl-xbeta, generated by an unspliced RNA,
RT   promotes apoptosis in promyeloid cells";
RL   J Biol Chem 271(22):13258-13265(1996).
XX
RN   [2]
RP   1-1748
RA   Shiraiwa N., Inohara N., Okada S., Yuzaki M., Shoji S., Ohta S.;
RT   ;
RL   Submitted (24-SEP-1996) to the INSDC.
RL   Division of Biochemistry, Institute of Gerontology, 1-396 Kosugi-cho,
RL   Nakahara-ku, Kawasaki City 211, Japan
XX
DR   MD5; 527081ae6cc309688f223d078a7cecaa.
DR   Ensembl-Gn; ENSRNOG00000007946; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000010762; rattus_norvegicus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1748
FT                   /organism="Rattus norvegicus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        164..862
FT                   /codon_start=1
FT                   /product="Bcl-xbeta"
FT                   /db_xref="GOA:P53563"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="PDB:1AF3"
FT                   /db_xref="PDB:4QNQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53563"
FT                   /protein_id="AAB17352.1"
FT                   /translation="MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPER
FT                   ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRA
FT                   FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLV
FT                   SRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLVCLSSVEIPNCPFWSPGMVVEDI
FT                   DYSGDIPGLL"
XX
SQ   Sequence 1748 BP; 401 A; 417 C; 478 G; 452 T; 0 other;
     cttagaacct ggactcagac cttcataaga gccacaaaga aaccaattct gaaccctatc        60
     ttggctttgg atcctggaag agaatcgcta aacacagagc agacccagtg agtgagcagg       120
     tgttttggac aatggactgg ttgagcccat ctctattata aaaatgtctc agagcaaccg       180
     ggagctggtg gttgactttc tctcctacaa gctctcccag aaaggataca gctggagtca       240
     gtttagcgat gtcgaagaga acaggactga agccccagaa gaaactgaac cagaaaggga       300
     gacccccagt gccatcaatg gcaacccatc ctggcacctg gcggatagcc ccgcggtgaa       360
     tggagccact ggccacagca gcagtttgga tgcgcgggag gtaatcccca tggcagcagt       420
     gaagcaagcg ctgagagagg ctggcgatga gtttgaactg cggtaccgga gagcattcag       480
     tgatctaaca tcccagcttc atataacccc agggacagca tatcagagct ttgaacaggt       540
     agtgaatgaa ctctttcggg atggggtaaa ctggggtcgc attgtggcct tcttctcctt       600
     tggcggggca ctgtgcgtgg aaagcgtaga caaggagatg caggtattgg tgagtcggat       660
     tgcaagttgg atggccacct acctgaatga ccacctagag ccttggatcc aggagaacgg       720
     cggctgggta agaaccacgc cccttgtgtg tccgcccctt gtgtgtctct cctctgtgga       780
     gatccctaac tgcccttttt ggtctcctgg catggttgtt gaagatatcg attattcagg       840
     agacattcct ggcttacttt aataccaggg gttaactttg ggaatattga tgaccctgtt       900
     tttaaggaac ctgtattttt cattctggct acccttgtgg ccccgcagtt tcatagtttt       960
     gttccaattt ctcggcaaag aaaaacagcc tgtgtgttta cttggcttaa aacctaggag      1020
     agtagcaagt tctccctgtg ttctgctcac tctcacgtaa tgggtcacct tggctggggg      1080
     gggaaggtaa tataatacct ggaggaactg cagagctgat aaccccaggc tcctgtgtgc      1140
     tcgcatgcat gctattcaga ccatttggtc aggcaggagc cccactggct tgactggctg      1200
     aatattgtct gattttagag aaggtggtct gagccaattg tgtttgtgct gtgcccctaa      1260
     gttcattttc accatggttg gcttgtttgg ggagcccttg ctgtgcccca ggactttgta      1320
     cctcactgcc ctggatcagt tggggatctc ccagctgctc tggcccagtg tttttctgct      1380
     cagggccctg gggcctcttt actaaagcac tgtttgctgc tggcagacac gaaccaggtc      1440
     tgtgaggctc cataggaaat taagatttgg tgacagactg gacgtgggtg tgagtcctga      1500
     ccctgtcact taactggcca tgtgaccttg gtcaggctga cttaccttct gggcctcagc      1560
     ttctcacaga ctgttgtgac tcttaaagat aaagcgagca gaagctgaca ccagtgagtg      1620
     ccttttcttc tgctcaccct tgtgctcacc agggtgagat agaggtgaga atgcccttac      1680
     tggtgaccac tgtggtaggc atttaccgtt cggagggaac tccattctgg aataggggag      1740
     aatgcgac                                                               1748
//

If you have problems or comments...

PBIL Back to PBIL home page