(data stored in ACNUC9552 zone)

EMBL: U72350

ID   U72350; SV 1; linear; mRNA; STD; ROD; 1742 BP.
XX
AC   U72350;
XX
DT   29-OCT-1996 (Rel. 49, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Rattus norvegicus Bcl-xalpha mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1742
RX   DOI; 10.1074/jbc.271.22.13258.
RX   PUBMED; 8662675.
RA   Shiraiwa N., Inohara N., Okada S., Yuzaki M., Shoji S., Ohta S.;
RT   "An additional form of rat Bcl-x, Bcl-xbeta, generated by an unspliced RNA,
RT   promotes apoptosis in promyeloid cells";
RL   J Biol Chem 271(22):13258-13265(1996).
XX
RN   [2]
RP   1-1742
RA   Shiraiwa N., Inohara N., Okada S., Yuzaki M., Shoji S., Ohta S.;
RT   ;
RL   Submitted (24-SEP-1996) to the INSDC.
RL   Division of Biochemistry, Institute of Gerontology, 1-396 Kosugi-cho,
RL   Nakahara-ku, Kawasaki City 211, Japan
XX
DR   MD5; ed14ee2a6f1cae45a515032960eaa0e1.
DR   Ensembl-Gn; ENSRNOG00000007946; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000010762; rattus_norvegicus.
DR   EuropePMC; PMC3006635; 20221856.
DR   EuropePMC; PMC3075634; 21257748.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1742
FT                   /organism="Rattus norvegicus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        72..773
FT                   /codon_start=1
FT                   /product="Bcl-xalpha"
FT                   /db_xref="GOA:P53563"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="PDB:1AF3"
FT                   /db_xref="PDB:4QNQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53563"
FT                   /protein_id="AAB17353.1"
FT                   /translation="MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPER
FT                   ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRA
FT                   FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLV
FT                   SRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAG
FT                   VVLLGSLFSRK"
XX
SQ   Sequence 1742 BP; 377 A; 507 C; 477 G; 381 T; 0 other;
     cacagagcag acccagtgag tgagcaggtg ttttggacaa tggactggtt gagcccatct        60
     ctattataaa aatgtctcag agcaaccggg agctggtggt tgactttctc tcctacaagc       120
     tctcccagaa aggatacagc tggagtcagt ttagcgatgt cgaagagaac aggactgaag       180
     ccccagaaga aactgaacca gaaagggaga cccccagtgc catcaatggc aacccatcct       240
     ggcacctggc ggatagcccc gcggtgaatg gagccactgg ccacagcagc agtttggatg       300
     cgcgggaggt aatccccatg gcagcagtga agcaagcgct gagagaggct ggcgatgagt       360
     ttgaactgcg gtaccggaga gcattcagtg atctaacatc ccagcttcat ataaccccag       420
     ggacagcata tcagagcttt gaacaggtag tgaatgaact ctttcgggat ggggtaaact       480
     ggggtcgcat tgtggccttc ttctcctttg gcggggcact gtgcgtggaa agcgtagaca       540
     aggagatgca ggtattggtg agtcggattg caagttggat ggccacctac ctgaatgacc       600
     acctagagcc ttggatccag gagaacggcg gctgggacac ttttgtggat ctctacggga       660
     acaatgcagc agccgagagc cggaaaggcc aggagcgttt caaccgctgg ttcctgacgg       720
     gcatgactgt ggctggtgta gttctgctgg gctcactctt cagtcggaag tgaccagaca       780
     ctgaccgtcc actcacctct cacctcccac cttgccccca ccacaactct ctcttcagcc       840
     accattgcta ccaggagaac cactacatgc aactcacgcc ccttccccta ttatagggtt       900
     gggcctagac ggagtcccct gcagttagct ttctagaatc taccacgctt ctgtgaaagc       960
     caccttcccc ccacatctca gttcccttgg cctcaaaact cacaaggttt ttcctcagat      1020
     cagctccttg gaggctggca ggagtgggaa ggggtgtgct agagggagaa gagcctgcct      1080
     tgttggtggg accctgatta cccctgagcc tctcgggaat gcttttctgg cagggagctg      1140
     gagagctctc taaacctctt cccccagaga ctagattgcc ttggttttga tgtgtgtggc      1200
     ctcagaattg atccatttcc cattctgctg tgtccctggg gcggctcctc cttcccatct      1260
     ccaccccccc ccccccagag ccattgagtg aggtgctttt agcccttttg actaactaaa      1320
     aatgcaggct gcttgggata acgaggcaag gacctcctcc ccacctgtgg cctggccaag      1380
     cccccactcc tggtctgaat gttctcctga ggcctctggc tagagtccag ccccacccag      1440
     gaggagggac ggagctgcgg aaagtccacc ctgcgagagc ctgagcggct cttgcggctt      1500
     agcaccaccc cagatccttc tccacccctc ccctggctcc atggtgacca tgactgaggg      1560
     accaactggg cccacgctag gtgccccaga gctgttaatg acttcagctg cctcacttcc      1620
     tgcaagatca gcctgtggca tctttgcctt gggtgctggc cacagggtcc agggactctg      1680
     gccttagccc agaagtgaga ggaagcttac agcgcagcta tgggagccct gggggcttcc      1740
     ct                                                                     1742
//

If you have problems or comments...

PBIL Back to PBIL home page