(data stored in ACNUC16935 zone)

EMBL: U72496

ID   U72496; SV 1; linear; mRNA; STD; MAM; 524 BP.
XX
AC   U72496;
XX
DT   25-OCT-1996 (Rel. 49, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 6)
XX
DE   Sus scrofa ubiquitin/ribosomal fusion protein mRNA, complete cds.
XX
KW   .
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-524
RX   DOI; 10.1016/S0014-5793(97)00177-4.
RX   PUBMED; 9089280.
RA   Chwetzoff S., d'Andrea S.;
RT   "Ubiquitin is physiologically induced by interferons in luminal epithelium
RT   of porcine uterine endometrium in early pregnancy: global RT-PCR cDNA in
RT   place of RNA for differential display screening";
RL   FEBS Lett. 405(2):148-152(1997).
XX
RN   [2]
RP   1-524
RA   Chwetzoff S.;
RT   ;
RL   Submitted (25-SEP-1996) to the INSDC.
RL   Laboratoire de Virologie et d'Immunologie Moleculaires, Institut National
RL   de le Recherche Agronomique, bat. 440 Domaine de Vilvert, Jouy en Josas
RL   78350, France
XX
DR   MD5; 861d2183ce7bbfaf425b84bcdec33588.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..524
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="pregnant gilt"
FT                   /tissue_type="uterine horn luminal epithelium"
FT                   /db_xref="taxon:9823"
FT   CDS_pept        36..422
FT                   /codon_start=1
FT                   /product="ubiquitin/ribosomal fusion protein"
FT                   /note="ubiquitin fused to L40 ribosomal protein"
FT                   /db_xref="GOA:P63053"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="PDB:3J7O"
FT                   /db_xref="PDB:3J7P"
FT                   /db_xref="PDB:3J7Q"
FT                   /db_xref="PDB:3J7R"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63053"
FT                   /protein_id="AAB52914.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
XX
SQ   Sequence 524 BP; 130 A; 161 C; 130 G; 103 T; 0 other;
     ctcttcaacg aggcggccga gcagcagacg cagagatgca gatctttgtg aagaccctga        60
     cgggcaagac catcaccctt gaggtcgagc ccagtgatac cattgagaat gtcaaagcta       120
     aaatccagga taaggagggc atcccacctg accagcagcg tctgattttt gctggcaaac       180
     agctggagga tggccgcact ctctcagact acaatatcca gaaagagtcc accctgcact       240
     tggtgcttcg tctgcgaggt ggcatcatcg agccctccct ccgccagctc gctcagaaat       300
     acaactgcga caagatgatc tgccgcaagt gttatgctcg cctgcatccc cgcgcggtga       360
     actgccgcaa gaagaagtgt ggccacacca acaacctgcg ccccaagaag aaggtcaaat       420
     aagacctttc caccagcttc tcctttgtct gcagggcagc ctcctgccca agccccatgg       480
     ccctggggcc tcaataaagt ttccctttcg ttgactggag cagt                        524
//

If you have problems or comments...

PBIL Back to PBIL home page