(data stored in ACNUC8465 zone)

EMBL: U74463

ID   U74463; SV 1; linear; mRNA; STD; MUS; 1299 BP.
XX
AC   U74463;
XX
DT   04-OCT-1997 (Rel. 52, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus MAP kinase kinase MKK7a (MKK7) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1299
RX   DOI; 10.1074/jbc.272.40.24994.
RX   PUBMED; 9312105.
RA   Holland P.M., Magali S., Campbell J.S., Noselli S., Cooper J.A.;
RT   "MKK7 is a stress-activated mitogen-activated protein kinase kinase
RT   functionally related to hemipterous";
RL   J Biol Chem 272(40):24994-24998(1997).
XX
RN   [2]
RP   1-1299
RA   Holland P.M., Cooper J.A.;
RT   ;
RL   Submitted (14-OCT-1996) to the INSDC.
RL   Basic Sciences, Fred Hutchinson Cancer Research Center, 1100 Fairview Ave.,
RL   A2-025, Seattle, WA 98109, USA
XX
DR   MD5; 32951d4f5da153715a529fc5de7ac3cb.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1299
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        28..1287
FT                   /codon_start=1
FT                   /gene="MKK7"
FT                   /product="MKK7a"
FT                   /note="MAP kinase kinase; similar to Drosophila hemipterous
FT                   gene product"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="AAC53364.1"
FT                   /translation="MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQL
FT                   PLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
FT                   YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRI
FT                   LMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKM
FT                   TVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCA
FT                   AYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEP
FT                   PLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMA
FT                   KTESPRTSGVLSQHHLPFFR"
XX
SQ   Sequence 1299 BP; 326 A; 362 C; 359 G; 252 T; 0 other;
     tgagcggcgg cagcggcggc ggggaagatg gcggcgtcct ccctggagca gaagctgtcc        60
     cgcctggaag ccaagctgaa gcaggagaac cgtgaggccc gcaggaggat cgacctcaac       120
     ttggatatca gcccacagcg gcccaggccc accctgcaac tcccactggc caacgatggg       180
     ggcagccgct caccatcctc agagagctcc ccacagcacc ctacaccccc cacccggccc       240
     cgccacatgc tggggctccc atcaaccttg ttcacaccgc gcagtatgga gagcatcgag       300
     attgaccaga agctgcagga gatcatgaag cagacagggt acctgactat cgggggccag       360
     cgttatcagg cagaaatcaa tgacttggag aacttgggtg agatgggcag tggtacctgt       420
     ggtcaggtgt ggaagatgcg gttccggaag acaggccaca tcattgctgt taagcaaatg       480
     cggcgctctg ggaacaagga agagaataag cgcattttga tggacctgga tgtagtactc       540
     aagagccatg actgccctta catcgttcag tgctttggca ccttcatcac caacacagac       600
     gtctttattg ccatggagct catgggcaca tgtgcagaga agctgaagaa acgaatgcag       660
     ggccccattc cagagcgaat cctgggcaag atgactgtgg cgattgtgaa agcactgtac       720
     tatctgaagg agaagcatgg cgtcatccat cgcgatgtca aaccctccaa catcctgcta       780
     gatgagcggg gccagatcaa gctctgtgac tttggcatca gtggccgtct tgttgactcc       840
     aaagccaaaa cacggagtgc tggctgtgct gcctatatgg ctcccgagcg catcgaccct       900
     ccagatccca ccaagcctga ctatgacatc cgagctgatg tgtggagcct gggcatctca       960
     ctggtggagc tggcaacagg acagttcccc tataagaact gcaagacgga ctttgaggtc      1020
     ctcaccaaag tcctacagga agagccccca ctcctgcctg gtcacatggg cttctcaggg      1080
     gacttccagt catttgtcaa agactgcctt actaaagatc acaggaagag accaaagtat      1140
     aataagctac ttgaacacag tttcatcaag cactatgaga tactcgaggt ggatgtcgcg      1200
     tcctggttta aggatgtcat ggcgaagacc gagtccccaa ggactagtgg agtcctgagt      1260
     cagcaccatc tgcccttctt caggtagcct catggcagc                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page