(data stored in ACNUC8465 zone)

EMBL: U74464

ID   U74464; SV 1; linear; mRNA; STD; MUS; 1188 BP.
XX
AC   U74464;
XX
DT   04-OCT-1997 (Rel. 52, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus MAP kinase kinase MKK7b (MKK7) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1188
RX   DOI; 10.1074/jbc.272.40.24994.
RX   PUBMED; 9312105.
RA   Holland P.M., Magali S., Campbell J.S., Noselli S., Cooper J.A.;
RT   "MKK7 is a stress-activated mitogen-activated protein kinase kinase
RT   functionally related to hemipterous";
RL   J Biol Chem 272(40):24994-24998(1997).
XX
RN   [2]
RP   1-1188
RA   Holland P.M., Cooper J.A.;
RT   ;
RL   Submitted (14-OCT-1996) to the INSDC.
RL   Basic Sciences, Fred Hutchinson Cancer Research Center, 1100 Fairview Ave.,
RL   A2-025, Seattle, WA 98109, USA
XX
DR   MD5; b03595cb917f11f37c1fbc66d3e39d34.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1188
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        1..1176
FT                   /codon_start=1
FT                   /gene="MKK7"
FT                   /product="MKK7b"
FT                   /note="MAP kinase kinase; similar to Drosophila hemipterous
FT                   gene product"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="AAC53365.1"
FT                   /translation="MLTPFMPLVFNSPALQLPLANDGGSRSPSSESSPQHPTPPTRPRH
FT                   MLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCG
FT                   QVWKMRFRKTGHIIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTD
FT                   VFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNIL
FT                   LDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLG
FT                   ISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKR
FT                   PKYNKLLEHSFIKHYEILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR"
XX
SQ   Sequence 1188 BP; 300 A; 328 C; 309 G; 251 T; 0 other;
     atgctaactc ctttcatgcc cctggttttt aattccccag ccctgcaact cccactggcc        60
     aacgatgggg gcagccgctc accatcctca gagagctccc cacagcaccc tacacccccc       120
     acccggcccc gccacatgct ggggctccca tcaaccttgt tcacaccgcg cagtatggag       180
     agcatcgaga ttgaccagaa gctgcaggag atcatgaagc agacagggta cctgactatc       240
     gggggccagc gttatcaggc agaaatcaat gacttggaga acttgggtga gatgggcagt       300
     ggtacctgtg gtcaggtgtg gaagatgcgg ttccggaaga caggccacat cattgctgtt       360
     aagcaaatgc ggcgctctgg gaacaaggaa gagaataagc gcattttgat ggacctggat       420
     gtagtactca agagccatga ctgcccttac atcgttcagt gctttggcac cttcatcacc       480
     aacacagacg tctttattgc catggagctc atgggcacat gtgcagagaa gctgaagaaa       540
     cgaatgcagg gccccattcc agagcgaatc ctgggcaaga tgactgtggc gattgtgaaa       600
     gcactgtact atctgaagga gaagcatggc gtcatccatc gcgatgtcaa accctccaac       660
     atcctgctag atgagcgggg ccagatcaag ctctgtgact ttggcatcag tggccgtctt       720
     gttgactcca aagccaaaac acggagtgct ggctgtgctg cctatatggc tcccgagcgc       780
     atcgaccctc cagatcccac caagcctgac tatgacatcc gagctgatgt gtggagcctg       840
     ggcatctcac tggtggagct ggcaacagga cagttcccct ataagaactg caagacggac       900
     tttgaggtcc tcaccaaagt cctacaggaa gagcccccac tcctgcctgg tcacatgggc       960
     ttctcagggg acttccagtc atttgtcaaa gactgcctta ctaaagatca caggaagaga      1020
     ccaaagtata ataagctact tgaacacagt ttcatcaagc actatgagat actcgaggtg      1080
     gatgtcgcgt cctggtttaa ggatgtcatg gcgaagaccg agtccccaag gactagtgga      1140
     gtcctgagtc agcaccatct gcccttcttc aggtagcctc atggcagc                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page