(data stored in ACNUC7421 zone)

EMBL: U74758

ID   U74758; SV 1; linear; genomic DNA; STD; PRO; 1173 BP.
XX
AC   U74758;
XX
DT   13-DEC-1996 (Rel. 50, Created)
DT   28-SEP-2003 (Rel. 77, Last updated, Version 4)
XX
DE   Salmonella typhimurium thiamine monophosphate kinase (thiL) gene, complete
DE   cds.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Typhimurium
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-1173
RX   DOI; 10.1074/jbc.272.25.15702.
RX   PUBMED; 9188462.
RA   Webb E., Downs D.;
RT   "Characterization of thiL, encoding thiamin-monophosphate kinase, in
RT   Salmonella typhimurium";
RL   J Biol Chem 272(25):15702-15707(1997).
XX
RN   [2]
RP   1-1173
RA   Webb E.A., Downs D.M.;
RT   ;
RL   Submitted (16-OCT-1996) to the INSDC.
RL   Department of Bacteriology, University of Wisconsin-Madison, 1550 Linden
RL   Dr., Madison, WI 53706, USA
XX
DR   MD5; 2f0443d705e37524a45a466c59ba7092.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1173
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhimurium"
FT                   /map="9.5 minutes"
FT                   /strain="LT2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:90371"
FT   gene            169..1146
FT                   /gene="thiL"
FT   CDS_pept        169..1146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /product="thiamine monphosphate kinase"
FT                   /function="converts thiamine monophosphate + ATP to
FT                   thiamnie pyrophophate + ADP"
FT                   /db_xref="GOA:P55881"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55881"
FT                   /protein_id="AAB37319.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVETGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPEVDEPWLEAFS
FT                   DSLFALLNYYDMQLIGGDTTRGPLSMTLGIHGYIPAGRALKRSGAKPGDWIYVTGTPGD
FT                   SAAGLAVLQNRLQVSEETDAHYLIQRHLRPTPRILHGQALRDIASAAIDLSDGLISDLG
FT                   HIVKASGCGARVDVDALPKSDAMMRHVDDGQALRWALSGGEDYELCFTVPELNRGALDV
FT                   AIGQLGVPFTCIGQMSADIEGLNFVRDGMPVTFDWKGYDHFATP"
XX
SQ   Sequence 1173 BP; 246 A; 286 C; 357 G; 284 T; 0 other;
     cctttaaggg cttaggagga tgatggaaaa cctgggggaa aacaccaaaa ttttacgggt        60
     acggaaagcg gttcggggat ttccaaacaa aagtattcac aggccggaaa aaagcggggt       120
     ggaaacccct tttccggcct tttttttttt tctgctgagg cataacgtat ggcatgtggc       180
     gagttttccc tgattgcccg ttattttgac cgtgtaagaa gctctcgtct tgatgttgaa       240
     accggtattg gcgacgattg cgcgctcctg aatattcctg aaaagcagac cctggcgatc       300
     agtaccgata cgctggtggc gggcaaccac ttcctccctg atatcgatcc tgccgatctg       360
     gcttataaag cgttggcggt gaatttaagc gatctggccg cgatgggggc cgacccggcc       420
     tggttaacgc tggcgttaac gctaccggaa gtggatgagc cgtggctgga ggcttttagc       480
     gacagcctgt ttgcgctatt gaattactac gatatgcagc tcattggcgg cgacaccacg       540
     cgtggaccgc tgtcgatgac gctgggtatc cacggttata tcccggcagg gcgcgcgctc       600
     aagcgatctg gcgcgaagcc gggcgactgg atttatgtca ccggtacgcc gggcgacagc       660
     gctgccgggc tggcggtttt gcaaaaccgg ctacaggtgt cggaggagac cgatgctcac       720
     tatttaattc aacggcattt acgtccgacg ccgcgtattt tacacggcca ggcgctgcgt       780
     gacatcgcca gcgcggctat cgatctttcc gatggtctga tttccgatct ggggcatatc       840
     gtcaaggcca gcggctgtgg ggctagagtg gatgttgatg cgttgccaaa atccgatgcg       900
     atgatgcgcc atgttgatga cgggcaggcg ctgcgttggg cgctttccgg cggcgaagac       960
     tatgagctgt gctttacggt gccggaactg aaccgtggcg cgctggatgt cgccattggt      1020
     caactgggtg ttccctttac ctgcataggc caaatgagcg cagatattga agggctgaat      1080
     tttgtacgtg acggaatgcc tgtcaccttc gactggaaag gatatgacca ttttgccacg      1140
     ccataaagat gttgcgaaaa gtcgcctgaa ttg                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page