(data stored in ACNUC27125 zone)

EMBL: U75348

ID   U75348; SV 1; linear; genomic DNA; STD; FUN; 907 BP.
XX
AC   U75348;
XX
DT   06-MAR-1997 (Rel. 51, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Kluyveromyces lactis Fo ATP synthase subunit 9, mitochondrial gene encoding
DE   mitochondrial protein, complete cds.
XX
KW   .
XX
OS   Kluyveromyces lactis
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
OG   Mitochondrion
XX
RN   [1]
RP   1-907
RA   Clark-Walker G.D.;
RT   "K. lactis mitochondrial Fo ATP synthase subunit 9";
RL   Unpublished.
XX
RN   [2]
RP   1-907
RA   Clark-Walker G.D.;
RT   ;
RL   Submitted (17-OCT-1996) to the INSDC.
RL   Molecular and Population Genetics, Research School of Biological Sciences
RL   Australian National University, Acton, Canberra, ACT 2601, Australia
XX
DR   MD5; 9388f6ba68eef1c97eb48b3c66d1e815.
DR   EuropePMC; PMC24159; 10570167.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..907
FT                   /organism="Kluyveromyces lactis"
FT                   /organelle="mitochondrion"
FT                   /strain="WM52"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:28985"
FT   CDS_pept        join(213..375,770..837)
FT                   /codon_start=1
FT                   /transl_table=3
FT                   /product="Fo ATP synthase subunit 9"
FT                   /db_xref="GOA:P92811"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:P92811"
FT                   /protein_id="AAB48406.1"
FT                   /translation="MQLVLAAKYIGAGISTIGLLGAGIGIAIVFSALIQGVSRNPSLKD
FT                   TLFPFAILGFALSEATGLFCLMISFLLLYAV"
XX
SQ   Sequence 907 BP; 360 A; 95 C; 106 G; 346 T; 0 other;
     gtcgattata tatattcata ttattctata tatatatata tatataagta attaattaat        60
     attatatatt tatattatta ttaatatata agatatatat tatttttttt taataatata       120
     tataataaaa tatatttatt ataaatatta tagtatattt tacatatatt attttataat       180
     atatttataa taaatattta taatataata acatgcaatt agtattagca gctaaatata       240
     ttggagcagg tatctcaaca attggattat taggagcagg tattggtatt gctatcgtat       300
     tctcagcctt aattcaagga gtatcaagaa acccatcatt aaaagataca ttattcccat       360
     tcgcaatttt aggataaaga gtgagtccta tttttcttat ttatcccgaa taatcttatt       420
     aaggttatgg gatataatta gaatataaaa ttgggtgaat tgcaagaaac tcctagtatt       480
     taataattat attaaatatg gacaatttgc agcgaagttt ataacaacct atattatatt       540
     attatataat aatcccacaa atgatagtgt ccaaccctca taaagggttg gacgatgccg       600
     cgtgggaagt tataaaaacg ttcaacgact agataatgag ttaggttaac aataatttat       660
     ccacgagcgc ccaatatcaa atagattata tttgataatg acatagtctg aacaatatag       720
     taatatattg agctaatata ttaaataaat attaggccaa catatatagt cgctttatca       780
     gaagctacag gattattctg tttaatgatt tcattcttat tattatacgc tgtataataa       840
     taacagaaag aaataaataa aaatataaat attcttttca tatatatata attatataaa       900
     tatttta                                                                 907
//

If you have problems or comments...

PBIL Back to PBIL home page