(data stored in ACNUC17492 zone)

EMBL: U77698

ID   U77698; SV 1; linear; mRNA; STD; ROD; 243 BP.
XX
AC   U77698;
XX
DT   06-MAR-1997 (Rel. 51, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Rattus norvegicus regulator of G-protein signaling 1 (RGS1) mRNA, partial
DE   cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-243
RA   Greenwood M.T., Guo Y., Hussain S.N.A.;
RT   "The rat RGS1 gene is expressed in multiple tissues";
RL   Unpublished.
XX
RN   [2]
RP   1-243
RA   Greenwood M.T., Guo Y., Hussain S.N.A.;
RT   ;
RL   Submitted (04-NOV-1996) to the INSDC.
RL   Medicine, McGill University, Royal Victoria Hospital, Room L3-05, 687 Pine
RL   Ave. W., Montreal, Quebec H3A 1A1, Canada
XX
DR   MD5; da941fde82eb0be169d7ff0bb520989e.
DR   Ensembl-Gn; ENSRNOG00000003895; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000005251; rattus_norvegicus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..243
FT                   /organism="Rattus norvegicus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="diaphram"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        <1..>243
FT                   /codon_start=1
FT                   /gene="RGS1"
FT                   /product="regulator of G-protein signaling 1"
FT                   /note="rgs1; first cloned in humans as IR20 and BL34"
FT                   /db_xref="GOA:P97844"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR030409"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97844"
FT                   /protein_id="AAB48300.1"
FT                   /translation="ANQMGQNVFGKFLKSEFSEENIEFWLACEDYKKTETDLLHNKAEH
FT                   IYKAFVHSDAVKQINIDFHTRESTAKKIKTPTPTCF"
XX
SQ   Sequence 243 BP; 88 A; 46 C; 47 G; 62 T; 0 other;
     gccaaccaga tgggtcaaaa tgtctttggg aaattcctaa agtctgaatt cagtgaagag        60
     aacattgaat tctggttggc ttgtgaagac tataagaaaa cagagactga tcttttgcat       120
     aacaaagcag agcatatata caaagcattt gtgcactcag atgctgtgaa acaaatcaat       180
     attgactttc atactcggga atcgacagcc aagaagatca aaacaccaac tcccacatgt       240
     ttt                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page